Anti-Hsc70 Rabbit Monoclonal Antibody [clone: ARC0258]
ANTIA305901-100
New Product
- Antibody type:Primary
- Antigen name:2410008N15Rik
- Antigen symbol:Hsc70
- Clonality:Monoclonal
- Clone:ARC0258
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# P11142
- Antigen synonyms:Epididymis luminal protein 33|Heat shock 70kDa protein 8|Heat shock cognate protein 54|Epididymis secretory sperm binding protein Li 72p|Heat shock 70kD protein 8|Heat shock 70 kDa protein 8|Heat shock 70kD protein 10|Heat shock cognate 71 kDa protein|Constitutive heat shock protein 70
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:71 kDa
- Sequence:FNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 547-646 of human Hsc70/HSPA8 (P11142).
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Rabbit monoclonal [ARC0258] antibody to Hsc70 for WB with samples derived from Human, Mouse and Rat.
- Validated Applications: WB
- Recommended Dilutions: WB: 1:500 to 1:2000
Type: Primary
Antigen: Hsc70
Clonality: Monoclonal
Clone: ARC0258
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat