Anti-Cullin 4A/CUL-4A Rabbit Monoclonal Antibody [clone: ARC1237]
Catalog # ANTIA305881-100
Supplier: Antibodies.com
New Product
Specifications
- Antibody type:Primary
- Antigen symbol:Cullin 4A / CUL-4A
- Clonality:Monoclonal
- Clone:ARC1237
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# Q13619
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:88 kDa
- Sequence:FKHKLFRIKINQIQMKETVEEQVSTTERVFQDRQYQIDAAIVRIMKMRKTLGHNLLVSELYNQLKFPVKPGDLKKRIESLIDRDYMERDKDNPNQYHYVA
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 660-759 of human Cullin 4A (Q13619).
- Tested applications:IHC
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit monoclonal [ARC1237] antibody to Cullin 4A/CUL-4A for WB and IHC with samples derived from Human.
- Validated Applications: WB, IHC
- Recommended Dilutions: WB: 1:500 to 1:2000, IHC: 1:50 to 1:200
Type: Primary
Antigen: Cullin 4A / CUL-4A
Clonality: Monoclonal
Clone: ARC1237
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human