Anti-SLC12A3 Rabbit Polyclonal Antibody
Catalog # ANTIA306874-100
Supplier: ANTIBODIES.COM
New Product
Specifications
- Antibody type:Primary
- Antigen name:FLJ96318
- Antigen symbol:SLC12A3
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Monkey,Human,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# P55017
- Antigen synonyms:NCC|NaCl electroneutral thiazide sensitive cotransporter|Na Cl cotransporter|Na-Cl symporter|Solute carrier family 12 (sodium/chloride transporters) member 3|NCCT|Na Cl symporter|S12A3_HUMAN|SLC12A3
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% glycerol and 0,01% Thiomersal
- Molecular weight:100 - 170 kDa
- Sequence:MAELPTTETPGDATLCSGRFTISTLLSSDEPSPPAAYDSSHPSHLTHSSTFCMRTFGYNTIDVVPTYEHYANSTQPGEPRKVRPTLADLHSFLKQEGRHLHALAFDSRPSHEMTDGLVEGEAGTSSEKNPEEPVRFGWVK
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human SLC12A3 (NP_000330.2).
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit polyclonal antibody to SLC12A3 for WB with samples derived from Human, Mouse and Monkey.
- Validated Applications: WB
- Recommended Dilutions: WB: 1:1000 to 1:5000
Type: Primary
Antigen: SLC12A3
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Monkey