Anti-GOLPH2 Rabbit Monoclonal Antibody [clone: ARC0697]
Catalog # ANTIA80822-100
Supplier: Antibodies.com
New Product
Specifications
- Antibody type:Primary
- Antigen name:bA379P1.3
- Antigen symbol:GOLPH2
- Clonality:Monoclonal
- Clone:ARC0697
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# Q8NBJ4
- Antigen synonyms:Golgi protein 73kD|Golgi protein 73 kD|C9orf155|GOLM1|Golgi membrane protein 1|Golgi membrane protein GP73|Chromosome 9 open reading frame 155|Golgi phosphoprotein 2|GOLM 1
- Storage buffer:Supplied in phosphate buffered saline, pH 7,3, with 50% Glycerol, 0,05% BSA, and 0,02% Sodium azide
- Molecular weight:73 kDa
- Sequence:VEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDD
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 250-350 of human GOLPH2 (Q8NBJ4)
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit monoclonal [ARC0697] antibody to GOLPH2 for WB with samples derived from human, mouse and rat.
- Validated applications: WB
- Recommended dilutions: WB: 1:500 to 1:200
Type: Primary
Antigen: GOLPH2
Clonality: Monoclonal
Clone: ARC0697
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat