Anti-NOX1 Rabbit Polyclonal Antibody
ANTIA10447-100
New Product
- Antibody type:Primary
- Antigen name:NADPH oxidase homolog 1
- Antigen symbol:NOX1
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# Q9Y5S8
- Antigen synonyms:GP91 2|MOX-1|NADH/NADPH mitogenic oxidase subunit P65-MOX|NADH/NADPH mitogenic oxidase subunit P65 MOX|MOX1|NADPH oxidase 1 variant NOH 1L|Mitogenic oxidase (pyridine nucleotide dependent superoxide generating)|NADPH oxidase 1|Mitogenic oxidase 1
- Storage buffer:Supplied in Phosphate Buffered Saline, pH 7,3, with 50% Glycerol and 0,02% Sodium Azide
- Molecular weight:65 kDa
- Sequence:KSIWYKFQCADHNLKTKKIYFYWICRETGAFSWFNNLLTSLEQEMEELGKVGFLNYRLFLTGWDSNIVGHAALNFDKATDIVTGLKQKTSFGRPMWDNEFSTIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 415 - 564 of human NOX1 (NP_008983.2)
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Rabbit polyclonal antibody to NOX1 for WB with samples derived from human, mouse and rat.
- Validated applications: WB
- Recommended dilutions: WB: 1:100 to 1:500
Type: Primary
Antigen: NOX1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat