Anti-TMEM16A Mouse Monoclonal Antibody [clone: DG1/447 + DOG-1.1]
Catalog # ANTIA249697-100
Supplier: ANTIBODIES.COM
New Product
Specifications
- Antibody type:Primary
- Antigen name:ANO 1
- Antigen symbol:TMEM16A
- Clonality:Monoclonal
- Clone:DG1/447 + DOG-1.1
- Conjugation:Unconjugated
- Host:Mouse
- ImmunoChemistry:Yes
- Isotype:Multiple
- Reactivity:Human
- Form:Liquid
- Gene ID:UniprotID# Q5XXA6
- Antigen synonyms:DOG 1|Discovered on gastrointestinal stromal tumors protein 1|Anoctamin1|Anoctamin 1 calcium activated chloride channel|Anoctamin 1|Anoctamin-1|Ca2+ activated Cl- channel|ANO1|ANO1_HUMAN
- Storage buffer:Supplied in 10 mM phosphate buffered saline with 0,05% BSA and 0,05% sodium azide
- Molecular weight:~114 kDa
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Concentration:200 µg/ml
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Clone DG1/447: Recombinant human DOG-1 protein. DOG-1.1: A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLL-ETCMEKERQKDEPPCNHHNTKACPDSLGSP-APSHAYHGGVL), conjugated to a carrier protein.
- Tested applications:IHC-P
- Purification:Protein A/G chromatography
- Pack type:Plastic vial
- Pk:100 µG
Specifications
About this item
Mouse monoclonal [DG1/447 + DOG-1.1] antibody to TMEM16A for IHC-P with samples derived from human.
- Validated applications: IHC-P
- Recommended dilutions: IHC-P: 1 to 2 µg/ml
Type: Primary
Antigen: TMEM16A
Clonality: Monoclonal
Clone: DG1/447 + DOG-1.1
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: Multiple
Reactivity: Human