Anti-RGC-32 Rabbit Polyclonal Antibody
ANTIA305287-100
New Product
- Antibody type:Primary
- Antigen symbol:RGC-32
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# Q9H4X1
- Storage buffer:Supplied in phosphate buffered saline, pH 7,3, with 50% glycerol and 0,01% thiomersal
- Molecular weight:15/20 kDa
- Sequence:ADFASPFHERHFHYEEHLERMKRRSSASVSDSSGFSDSESADSLYRNSFSFSDEKLNSPTD
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 40 - 100 of human RGCC (NP_054778.2).
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Rabbit polyclonal antibody to RGC-32 for WB with samples derived from human, mouse and rat.
- Validated applications: WB
- Recommended dilutions: WB: 1:500 to 1:2000
Type: Primary
Antigen: RGC-32
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat