Anti-Aquaporin-7 Rabbit Polyclonal Antibody
Catalog # NOVUNBP1-54384
Supplier: Novus Biologicals
Specifications
- Druh protilátky:Primární
- Název antigenu:Aquaporin-7
- Symbol antigenu:AQP7
- Klonovalita:Polyclonal
- Spojení:Unconjugated
- Hostitel:Rabbit
- Izotyp:IgG
- Reaktivita:Human
- Western blot:Yes
- Identifikační číslo genu:364
- Synonyma antigenu:Aquaporin-7-like|AQP7L|Aquaglyceroporin-7|AQP-7|aquaporin-7|AQP9MGC149556|aquaporin 7|Aquaporin adipose|AQPapaquaglyceroporin-7|MGC149555
- Skladovací pufr:PBS & 2% Sucrose,
- Skladovací teplota:Store at -20 °C. Avoid freeze-thaw cycles.
- Imunogen:Synthetic peptides corresponding to AQP7 (aquaporin 7) The peptide sequence was selected from the C terminal of AQP7. Peptide sequence DSVAYEDHGITVLPKMGSHEPTISPLTPVSVSPANRSSVHPAPPLHESMA.
- Čištění:Immunogen affinity purified
- Rozměry protilátky:100 μl
- Bal.:100 µl
Specifications
About this item
The Aquaporin-7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Aquaporin-7. This antibody reacts with human. The Aquaporin-7 Antibody has been validated for the following applications: Western Blot.
Type: Primary
Antigen: Aquaporin-7
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human