Mouse Recombinant IL-19 (from E. coli)
Supplier: Shenandoah Biotechnology
Certificates
About this item
Interleukin-19 (IL-19) is a member of the interleukin 10 (IL-10) cytokine family and is produced by B cells and monocytes. IL-19 binds the interleukin 20 receptor complex (IL-20R) to activate STAT3 signaling. IL-19 induces interleukin 6 (IL-6) and tumor necrosis factor alpha (TNF-α) expression in monocytes, and promotes type 2 T helper (Th2) cell-mediated immune responses. IL-19 production is upregulated in resting monocytes following granulocyte-macrophage colony-stimulating factor (GM-CSF) or lipopolysaccharide (LPS) stimulation.
- High quality
- Low endotoxin
- Affordable
IL-19 production is upregulated in resting monocytes following granulocyte-macrophage colony-stimulating factor (GM-CSF) or lipopolysaccharide (LPS) stimulation.
Certifications: Animal-Free (AF) proteins are identical to regular proteins and offer additional documentation showing that they were produced with no materials of animal or human origin using ANIMAL-FREE purification processes.
Caution: For research use only.
Specifications
- Spojení:Unconjugated
- Proteinový podtyp:Cytokine
- Typ proteinu/peptidu:Recombinant
- Zdroj:E. coli
- Druhy:Mouse
- Podmínky uskladnění:−20 °C
- Obsah endotoxinů:Endotoxin LAL (EU/µg) ≤0.1
- Biologická aktivita:Bioactivity: No biological activity data is available at this time
- Identifikační číslo genu:Q8CJ70
- Pokyny pro rekonstituce:Sterile water at 0,1 mg/ml
- Bez obsahu endotoxinů:N
- Bez nosiče:Y
- Bez obsahu proteázy:N
- Bez obsahu živočichů:N
- Proteinová synonyma:IL19|IL-19|Interleukin 19
- UniProtKB:Q8CJ70
- Název proteinu/peptidu:IL-19
- Čistota:≥95%
- Molekulární hmotnost:17,7 kDa
- Sekvence:MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA
- Úroveň endotoxinů:Low
- Formulace:10 mM sodium phosphate, 50 mM sodium chloride, pH 7,5
- Bez nukleáz:N
- Třída:RUO
- Transportní teplota:RT
Specifications
Frequently Bought Together