Human recombinant betaDefensin 1 (from E. coli)
Supplier: Biorbyt
Certificates
About this item
Specifications
- Spojení:Unconjugated
- Typ proteinu/peptidu:Recombinant
- Zdroj:E. coli
- Druhy:Human
- Podmínky uskladnění:Store at −20 °C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 °C for 2-7 days. Aliquots of reconstituted samples are stable at −20 °C for 3 months.
- UniProtKB:P60022 (Human)
- Název proteinu/peptidu:betaDefensin 1
- Čistota:>95% as determined by reducing SDS-PAGE.
- Sekvence:GNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK
- Formulace:Lyophilized from a 0.2 um filtered solution of 20mM PB, 130mM NaCl, pH 7.4.
- Testované aplikace:SDS-PAGE
Specifications
Frequently Bought Together