Anti-GOT2 Rabbit Polyclonal Antibody
100 μL
Catalog # ABNOPAB30106
Supplier: Abnova
Jump to:
Product Details & Documents
Rabbit polyclonal antibody raised against synthetic peptide of human GOT2.
Type: Primary
Antigen: GOT2
Clonality: Polyclonal
Clone:
Conjugation:
Epitope:
Host: Rabbit
Isotype:
Reactivity: Human
Specifications
- Size:100 μL
- Western blot:Yes
- Cat. No.:ABNOPAB30106
- Clonality:Polyclonal
- Reactivity:Human
- Antibody type:Primary
- Gene ID:2806
- Host:Rabbit
- ImmunoChemistry:Yes
- Sequence:AILNTPDLRKQWLQEVKVMADRIIGMRTQLVSNLKKEGSTHNWQHITDQI
- Antigen symbol:GOT2
Recommendations
Recommendations will be personalized based on your shopping preferences only if you have given your consent by enabling "Enhance my Shopping Experience" on the "Personal Info page".
Otherwise, you will receive generic recommendations.
Acetonitrile, anhydrous (max. 0.003% H₂O) ≥99.95%, HiPerSolv CHROMANORM® Reag. USP, Reag. Ph. Eur., ACS, super gradient grade suitable for UPLC/UHPLC instruments
Catalog #: 83639.320
Supplier: VWR Chemicals
Methanol ≥99.8%, HiPerSolv CHROMANORM® Reag. Ph. Eur., gradient grade for HPLC
Catalog #: 20864.320
Supplier: VWR Chemicals
Acetonitrile ≥99.9%, HiPerSolv CHROMANORM® for LC-MS, suitable for UPLC/UHPLC instruments
Catalog #: 83640.320
Supplier: VWR Chemicals
Acetonitrile ≥99.9%, LiChrosolv® Reag. Ph. Eur., gradient grade for liquid chromatography, Supelco®
Catalog #: 1.00030.2500
Supplier: Merck
Sodium hydroxide 0.1 mol/l (0.1 N) in aqueous solution, AVS TITRINORM Reag. Ph. Eur. volumetric solution
Catalog #: 31770.294
Supplier: VWR Chemicals
Water, HiPerSolv CHROMANORM® for LC-MS, suitable for UPLC/UHPLC instruments
Catalog #: 83645.320
Supplier: VWR Chemicals
Buffer solutions, ready to use, referenced at 20 °C, Certipur®, Supelco®
Catalog #: 1.09439.1000
Supplier: Merck