Anti-CFAP20 Rabbit Polyclonal Antibody
ABNOPAB21020
: Abnova
- Antibody type:Primary
- Antigen name:Cilia and flagella associated protein 20
- Antigen symbol:CFAP20
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human
- Cross adsorption:No
- Format:Liquid
- Gene ID:29105
- Antigen synonyms:GTL3|C16orf80|EVORF|fSAP23
- Storage buffer:PBS, pH 7,5 (40% glycerol, 0,02% sodium azide)
- Sequence:GFLSILYSIGSKPLQIWDKKVRNGHIKRITDNDIQSLVLEIEGTNVSTTYITCPADPKKTLGIKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDDGWNQIQFNLL
- Storage temperature:Store at 4 °C. For long term storage store at –20 °C. Aliquot to avoid repeated freezing and thawing.
- Immunogen:Recombinant protein corresponding to amino acids of human C16orf80.
- Purification:Antigen affinity purification
- Size:100 μl
- Pk:100 µl
Rabbit polyclonal antibody raised against recombinant C16orf80.
Type: Primary
Antigen: CFAP20
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human