Anti-Brain Natriuretic Peptide Mouse Monoclonal Antibody [clone: 17-16]
Supplier: US Biological
Certificates
About this item
Type: Primary
Antigen: Brain Natriuretic Peptide
Clonality: Monoclonal
Clone: 17-16
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG1
Reactivity: Human,
Specifications
- Catalog No:
- USBIB2702-33E-10
- USBIB2702-33E-100
- Antigen symbol:
- BNP
- BNP
- Antigen name:
- Brain Natriuretic Peptide
- Brain Natriuretic Peptide
- Antibody type:
- Primary
- Primary
- Clonality:
- Monoclonal
- Monoclonal
- Conjugation:
- Unconjugated
- Unconjugated
- Clone:
- 17-16
- 17-16
- Reactivity:
- Human
- Human
- Host:
- Mouse
- Mouse
- Isotype:
- IgG1
- IgG1
- ELISA:
- Yes
- Yes
- Immunogen:
- Synthetic human BNP (aa 1-32) KLH conjugated (SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH)
- Synthetic human BNP (aa 1-32) KLH conjugated (SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH)
- Amino acid number:
- 1 to 32
- 1 to 32
- Sequence:
- SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
- Form:
- lyophilized powder
- lyophilized powder
- Purification:
- purified by Protein G chromatography
- purified by Protein G chromatography
- Concentration:
- ~1 mg/ml
- ~1 mg/ml
- Cross adsorption:
- No
- No
- Storage buffer:
- PBS, pH 7,2
- PBS, pH 7,2
- Storage temperature:
- –20 °C
- –20 °C
Specifications
Frequently Bought Together
Sealing film for manual application, Parafilm® M
Supplier: HEATHROW
Acetone ≥99%, TECHNICAL
Supplier: VWR Chemicals
Water, HiPerSolv CHROMANORM® for HPLC
Supplier: VWR Chemicals
Methanol ≥99.8%, HiPerSolv CHROMANORM® Reag. Ph. Eur., gradient grade for HPLC
Supplier: VWR Chemicals
VWR® Serological Pipette, Standard Line
Supplier: VWR Collection
Nitrile gloves, Kimtech™ Purple Nitrile™
Supplier: KIMBERLY CLARK
VWR® Facial Tissues
Supplier: VWR Collection
VWR®, Nitrile Gloves
Supplier: VWR Collection
Acetonitrile ≥99.9%, HiPerSolv CHROMANORM® for LC-MS, suitable for UPLC/UHPLC instruments
Supplier: VWR Chemicals
VWR®, Transfer Pipettes, High Performance
Supplier: VWR Collection
VWR® NITRILE LIGHT, Nitrile Gloves
Supplier: VWR Collection