Order Entry
Czech Republic
ContactUsLinkComponent
Anti-SFTPA1/2 Rabbit Polyclonal Antibody
Anti-SFTPA1/2 Rabbit Polyclonal Antibody
Catalog # BSBTPB9390
Supplier:  Boster Bio
undefined
Anti-SFTPA1/2 Rabbit Polyclonal Antibody
Catalog # BSBTPB9390
Supplier:  Boster Bio

Specifications

  • Antibody type:
    Primary
  • Antigen name:
    Pulmonary surfactant-associated protein A1/2
  • Antigen symbol:
    SFTPA1/2
  • Clonality:
    Polyclonal
  • Host:
    Rabbit
  • ImmunoChemistry:
    Yes
  • Isotype:
    IgG
  • Reactivity:
    Human,
    Rat,
    Mouse
  • Western blot:
    Yes
  • Environmentally Preferable:
  • Form:
    Lyophilized
  • Gene ID:
    653509/729238
  • Antigen synonyms:
    Pulmonary surfactant-associated protein A1/Pulmonary surfactant-associated protein A2
  • UniProtKB:
    Q8IWL1/Q8IWL2
  • Storage temperature:
    At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
  • Immunogen:
    A synthetic peptide corresponding to a sequence at the C-terminus of human
    SFTPA1/2(206-237aa VNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRN), different from the related mouse sequence by four amino acids, and from the related rat sequence by five amino acids.
  • Purification:
    Immunogen affinity purified.
  • Size:
    100 µg/vial
  • Pk:
    100 µG

Specifications

About this item

Rabbit IgG polyclonal antibody for Pulmonary surfactant-associated protein A1/Pulmonary surfactant-associated protein A2(SFTPA1/2) detection. Tested with WB, IHC-P, IHC-F in Human;Mouse;Rat.

SFTPA1/2 is also known as SP-A. SFTPA1 encodes a lung surfactant protein that is a member of a subfamily of C-type lectins called collectins. The encoded protein binds specific carbohydrate moieties found on lipids and on the surface of microorganisms. This protein plays an essential role in surfactant homeostasis and in the defense against respiratory pathogens. Mutations in this gene are associated with idiopathic pulmonary fibrosis. Alternate splicing results in multiple transcript variants. SFTPA2 is one of several genes encoding pulmonary-surfactant associated proteins (SFTPA) located on chromosome 10. Mutations in this gene and a highly similar gene located nearby, which affect the highly conserved carbohydrate recognition domain, are associated with idiopathic pulmonary fibrosis. The current version of the assembly displays only a single centromeric SFTPA gene pair rather than the two gene pairs shown in the previous assembly which were thought to have resulted from a duplication.

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

WB: The detection limit for SFTPA1/2 is approximately 0.1ng/lane under reducing conditions.
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Optimal dilutions should be determined by end users.

Type: Primary
Antigen: SHC1
Clonality: Polyclonal
Clone:
Conjugation:
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat