Order Entry
Czech Republic
ContactUsLinkComponent
Anti-HKDC1 Rabbit Polyclonal Antibody
Anti-HKDC1 Rabbit Polyclonal Antibody
Catalog # BSBTPB9375
Supplier:  Boster Bio
undefined
Anti-HKDC1 Rabbit Polyclonal Antibody
Catalog # BSBTPB9375
Supplier:  Boster Bio

Specifications

  • Antibody type:
    Primary
  • Antigen name:
    Hexokinase domain containing 1
  • Antigen symbol:
    HKDC1
  • Clonality:
    Polyclonal
  • Host:
    Rabbit
  • Isotype:
    IgG
  • Reactivity:
    Human
  • Western blot:
    Yes
  • Form:
    Lyophilized
  • Gene ID:
    80201
  • UniProtKB:
    Q2TB90
  • Storage temperature:
    At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
  • Immunogen:
    A synthetic peptide corresponding to a sequence at the N-terminus of human HKDC1(102-136aa KRHVQMESQFYPTPNEIIRGNGTELFEYVADCLAD), different from the related mouse sequence by four amino acids.
  • Purification:
    Immunogen affinity purified.
  • Size:
    100 µg/vial
  • Pk:
    100 µG

Specifications

About this item

Rabbit IgG polyclonal antibody for Putative hexokinase HKDC1(HKDC1) detection. Tested with WB in Human.

The epidermal growth factor receptor (HKDC1; ErbB-1; HER1 in humans) is the cell-surface receptor for members of the epidermal growth factor family (EGF-family) of extracellular protein ligands. It is a member of the ErbB family of receptors, a subfamily of four closely related receptor tyrosine kinases: HKDC1 (ErbB-1), HER2/c-neu (ErbB-2), Her 3 (ErbB-3) and Her 4 (ErbB-4). HKDC1 exists on the cell surface and is activated by binding of its specific ligands, including epidermal growth factor and transforming growth factor ? (TGF?). HKDC1 and its ligands are cell signaling molecules involved in diverse cellular functions, including cell proliferation, differentiation, motility, and survival, and in tissue development. Mutations that lead to HKDC1 overexpression (known as upregulation) or overactivity have been associated with a number of cancers, including lung cancer and glioblastoma multiforme. In this latter case a more or less specific mutation of HKDC1, called HKDC1vIII is often observed.

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

WB: The detection limit for HKDC1 is approximately 0.1ng/lane under reducing conditions.
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Optimal dilutions should be determined by end users.

Type: Primary
Antigen: HLA-A
Clonality: Polyclonal
Clone:
Conjugation:
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat