Anti-COX1 / Cyclooxygenase 1 Rabbit Monoclonal Antibody [clone: ARC0960]
Katalogové číslo ANTIA306059-100
Dodavatel: ANTIBODIES.COM
New Product
Specifikace
- Druh protilátky:Primární
- Název antigenu:COX 1
- Symbol antigenu:COX1 / Cyclooxygenase 1
- Klonovalita:Monoclonal
- Klon:ARC0960
- Spojení:Unconjugated
- Hostitel:Rabbit
- Izotyp:IgG
- Reaktivita:Human,Rat,Mouse
- Western blot:Yes
- Formulář:Liquid
- Identifikační číslo genu:UniprotID# P23219
- Synonyma antigenu:EC 1.14.99.1|Cox3|Partial COX1 proteins, included|COX1|Cyclooxygenase-1|Cyclooxygenase 3, included|COX1 / Cyclooxygenase 1|COX-1|COX 3
- Skladovací pufr:Supplied in Phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molekulární hmotnost:65 kDa/72 kDa
- Sekvence:GLDRYQCDCTRTGYSGPNCTIPGLWTWLRNSLRPSPSFTHFLLTHGRWFWEFVNATFIREMLMRLVLTVRSNLIPSPPTYNSAHDYISWESFSNVSYYTRI
- Skladovací teplota:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Transportní teplota:Shipped on blue ice at 4 °C
- Imunogen:A synthetic peptide corresponding to a sequence within amino acids 50-150 of human COX1/PTGS1 (P23219).
- Čištění:Affinity purification
- Typ balení:Plastic vial
- Bal.:100 µl
Specifikace
O tomto produktu
Rabbit monoclonal [ARC0960] antibody to COX1 / Cyclooxygenase 1 for WB with samples derived from Human, Mouse and Rat.
- Validated Applications: WB
- Recommended Dilutions: WB: 1:500 to 1:2000
Type: Primary
Antigen: COX1 / Cyclooxygenase 1
Clonality: Monoclonal
Clone: ARC0960
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat