Anti-GAD65 Rabbit Polyclonal Antibody
Catalog # ANTIA12729-100
Supplier: ANTIBODIES.COM
New Product
Specifications
- Druh protilátky:Primární
- Název antigenu:65 kDa glutamic acid decarboxylase
- Symbol antigenu:GAD65
- Klonovalita:Polyclonal
- Spojení:Unconjugated
- Hostitel:Rabbit
- Imunochemie:Yes
- Izotyp:IgG
- Reaktivita:Human,Rat,Mouse
- Western blot:Yes
- Formulář:Liquid
- Identifikační číslo genu:UniprotID# Q05329
- Synonyma antigenu:GAD 65|GAD65|GAD-65|Gad2|DCE 2|GAD 2|GAD-2|DCE2|DCE2_HUMAN
- Skladovací pufr:Supplied in Phosphate buffered saline, pH 7,3, with 50% Glycerol and 0,01% Thiomersal
- Molekulární hmotnost:60 kDa
- Sekvence:PLQCSALLVREEGLMQNCNQMHASYLFQQDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTTGFEAHVDKCLELAEYLYNIIKNREGYEMVFDGKPQHTNVCFWYIPPSLRTLEDNEERMSRLSKVAPVIKARMMEYGTTMVSYQPLGDKVNFFRMVISNPAATHQDIDFLIEEIERLGQDL
- Skladovací teplota:Shipped at 4 °C. Upon delivery aliquot and store at ‒20 °C. Avoid freeze / thaw cycles.
- Transportní teplota:Shipped on blue ice at 4 °C
- Imunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 401-585 of human GAD65/GAD2 (NP_001127838.1)
- Testované aplikace:ICC/IF
- Čištění:Affinity purification.
- Typ balení:Plastic vial
- Bal.:100 µl
Specifications
About this item
Rabbit polyclonal antibody to GAD65 for WB and ICC/IF with samples derived from human, mouse and rat.
- Validated applications: WB, ICC/IF
- Recommended dilutions: WB: 1:500 to 1:1000, ICC/IF: 1:50 to 1:20
Type: Primary
Antigen: GAD65
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat