Anti-ELK1 Rabbit Polyclonal Antibody
Katalogové číslo ANTIA12697-100
Dodavatel: ANTIBODIES.COM
New Product
Specifikace
- Druh protilátky:Primární
- Název antigenu:ELK 1
- Symbol antigenu:ELK1
- Klonovalita:Polyclonal
- Spojení:Unconjugated
- Hostitel:Rabbit
- Izotyp:IgG
- Reaktivita:Human,Rat,Mouse
- Western blot:Yes
- Formulář:Liquid
- Identifikační číslo genu:UniprotID# P19419
- Synonyma antigenu:ETS domain containing protein Elk1|ELK1|ELK1_HUMAN|ELK1, ETS transcription factor|ELK1 protein|ELK2 member of ETS oncogene family|ELK1 member of ETS oncogene family|ETS domain containing protein Elk 1|ETS domain protein Elk1
- Skladovací pufr:Supplied in Phosphate buffered saline, pH 7,3, with 50% Glycerol and 0,05% Proclin 300
- Molekulární hmotnost:62 kDa
- Sekvence:PSPLEACLEAEEAGLPLQVILTPPEAPNLKSEELNVEPGLGRALPPEVKVEGPKEELEVAGERGFVPETTKAEPEVPPQEGVPARLPAVVMDTAGQA
- Skladovací teplota:Shipped at 4 °C. Upon delivery aliquot and store at ‒20 °C. Avoid freeze / thaw cycles.
- Transportní teplota:Shipped on blue ice at 4 °C
- Imunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 201-297 of human ELK1 (NP_005220.2)
- Čištění:Affinity purification.
- Typ balení:Plastic vial
- Bal.:100 µl
Specifikace
O tomto produktu
Rabbit polyclonal antibody to ELK1 for WB with samples derived from human, mouse and rat.
- Validated applications: WB
- Recommended dilutions: WB: 1:500 to 1:100
Type: Primary
Antigen: ELK1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat