Anti-SGLT2/SLC5A2 Rabbit Polyclonal Antibody
NOVUNBP1-92384
New Product
- Druh protilátky:Primární
- Symbol antigenu:SGLT2/SLC5A2
- Klonovalita:Polyclonal
- Spojení:Unconjugated
- Hostitel:Rabbit
- Imunochemie:Yes
- ImunoFluorescence:Yes
- Izotyp:IgG
- Reaktivita:Human
- Western blot:Yes
- Identifikační číslo genu:6524
- Synonyma antigenu:solute carrier family 5 (sodium/glucose transporter)|solute carrier family 5 (sodium/glucose cotransporter)|Na(+)/glucose cotransporter 2|member 2|Low affinity sodium-glucose cotransporter|Solute carrier family 5 member 2|SGLT2sodium/glucose cotransporter 2
- Skladovací pufr:PBS (pH 7,2) and 40% Glycerol
- Skladovací teplota:Store at +4 °C short term. Aliquot and store at −20 °C long term. Avoid freeze-thaw cycles.
- Imunogen:This antibody was developed against Recombinant Protein corresponding to amino acids:FHEVGGYSGLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLL.
- Čištění:Immunogen affinity purified
- Bal.:0,1 mL
The SGLT2 / SLC5A2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SGLT2 / SLC5A2. This antibody reacts with human. The SGLT2 / SLC5A2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: SGLT2/SLC5A2
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human