Human Recombinant PPM1B
Catalog # ORIGTP312918
Supplier: OriGene
CAS Number:
Specifications
- Bal.:20 µG
- Typ proteinu/peptidu:Recombinant
- Druhy:Human
- Sekvence značek:C-Myc/DDK
- Podmínky uskladnění:Store at −80 °C
- Proteinová synonyma:PP2C-beta|protein phosphatase 1B, magnesium-dependent, beta isoform|PPC2BETAX|PP2CBETA|PP2CB|PP2C-beta-X
- UniProtKB:O75688
- Název proteinu/peptidu:PPM1B
- Čistota:>80% as determined by SDS-PAGE and Coomassie blue staining
- Molekulární hmotnost:52,5 kDa
- Sekvence:MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLEDWSFFAVYDGHAGSRVANY
CSTHLLEHITTNEDFRAAGKSGSALELSVENVKNGIRTGFLKIDEYMRNFSDLRNGMDRSGSTAVGVMIS
PKHIYFINCGDSRAVLYRNGQVCFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCV
DGKGPTEQLVSPEPEVYEILRAEEDEFIILACDGIWDVMSNEELCEYVKSRLEVSDDLENVCNWVVDTCL
HKGSRDNMSIVLVCFSNAPKVSDEAVKKDSELDKHLESRVEEIMEKSGEEGMPDLAHVMRILSAENIPNL
PPGGGLAGKRNVIEAVYSRLNPHRESDGASDEAEESGSQGKLVEALRQMRINHRGNYRQLLEEMLTSYRL
AKVEGEESPAEPAATATSSNSDAGNPVTMQESHTESESGLAELDSSNEDAGTKMSGEKI
myc-FLAG tag - Koncentrace:>0,05 µg/µl as determined by microplate BCA method
Specifications
About this item
The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways.
- Expression host: HEK293T
- Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7,3, 10% glycerol
Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
This phosphatase has been shown to dephosphorylate cyclin-dependent kinases (CDKs), and thus may be involved in cell cycle control. Overexpression of this phosphatase is reported to cause cell-growth arrest or cell death. Alternative splicing results in multiple transcript variants encoding different isoforms. Additional transcript variants have been described, but currently do not represent full-length sequences.
Caution: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.