Human recombinant CXADR (from HEK293 cells)
: Biorbyt
- Spojení:Unconjugated
- Typ proteinu/peptidu:Recombinant
- Zdroj:HEK293 cells
- Druhy:Human
- Podmínky uskladnění:Store at −20 °C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 °C for 2-7 days. Aliquots of reconstituted samples are stable at −20 °C for 3 months.
- Proteinová synonyma:Coxsackievirus and Adenovirus Receptor
- UniProtKB:P78310 (Human)
- Název proteinu/peptidu:CXADR
- Čistota:>95% as determined by reducing SDS-PAGE.
- Sekvence:LSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIYDDYY PDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVLVKPSGARCYVD GSEEIGSDFKIKCEPKEGSLPLQYEWQKLSDSQKMPTSWLAEMTSSVISVKNASSEYSGTYSCTV RNRVGSDQCLLRLNVVPPSNKAGVDHHHHHH
- Formulace:Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
- Testované aplikace:SDS-PAGE
Frequently Bought Together