Human Recombinant FOXA1
Product Details & Documents
This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver.
- Expression host: HEK293T
- Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7,3, 10% glycerol
Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Caution: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Specifications
Specifications
- Conf:20 µG
- Peso molecolare:49 kDa
- Cat. No.:ORIGTP306045
- Condizioni di conservazione:Store at −80 °C
- Protein/peptide type:Recombinant
- Protein/peptide name:FOXA1
- Purezza:>80% as determined by SDS-PAGE and Coomassie blue staining
- Protein synonyms:HNF3A|forkhead box A1|TCF3A
- UniProtKB:P55317
- Specie:Human
- Sequenza:MLGTVKMEGHETSDWNSYYADTQEAYSSVPVSNMNSGLGSMNSMNTYMTMNTMTTSGNMTPASFNMSYAN<br />PGLGAGLSPGAVAGMPGGSAGAMNSMTAAGVTAMGTALSPSGMGAMGAQQAASMNGLGPYAAAMNPCMSP<br />MAYAPSNLGRSRAGGGGDAKTFKRSYPHAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQN<br />QQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWTLHPDSGNMFENGCYLRRQKRFKCEKQPGAGGGGGS<br />GSGGSGAKGGPESRKDPSGASNPSADSPLHRGVHGKTGQLEGAPAPGPAASPQTLDHSGATATGGASELK<br />TPASSTAPPISSGPGALASVPASHPAHGLAPHESQLHLKGDPHYSFNHPFSINNLMSSSEQQHKLDFKAY<br />EQALQYSPYGSTLPASLPLGSASVTTRSPIEPSALEPAYYQGVYSRPVLNTS<br /><br />myc-FLAG tag
- Concentrazione:>0,05 µg/µl as determined by microplate BCA method
- Sequenza tag:C-Myc/DDK
Specifications
Recommendations will be personalized based on your shopping preferences only if you have given your consent by enabling "Enhance my Shopping Experience" on the "Personal Info page".
Otherwise, you will receive generic recommendations.



