Recombinant DegP from E. coli
About this item
DegP acts as a chaperone at low temperatures but switches to a peptidase (heat shock protein) at higher temperatures. It degrades transiently denatured and unfolded proteins which accumulate in the periplasm following heat shock or other stress conditions.
- Recombinant protein corresponding to aa 27 - 474 from E. coli degP, fused to His-Tag at N-terminal, expressed in Yeast
DegP is efficient with Val-Xaa and Ile-Xaa peptide bonds, suggesting a preference for beta-branched side chain amino acids. Only unfolded proteins devoid of disulfide bonds appear capable of being cleaved, thereby preventing non-specific proteolysis of folded proteins. Its proteolytic activity is essential for the survival of cells at elevated temperatures. It can degrade IciA, ada, casein, globin and PapA. DegP shares specificity with DegQ. DegP is also involved in the biogenesis of partially folded outer-membrane proteins (OMP).
2 Options Available Below
Product Details & Documents
DegP acts as a chaperone at low temperatures but switches to a peptidase (heat shock protein) at higher temperatures. It degrades transiently denatured and unfolded proteins which accumulate in the periplasm following heat shock or other stress conditions.
- Recombinant protein corresponding to aa 27 - 474 from E. coli degP, fused to His-Tag at N-terminal, expressed in Yeast
DegP is efficient with Val-Xaa and Ile-Xaa peptide bonds, suggesting a preference for beta-branched side chain amino acids. Only unfolded proteins devoid of disulfide bonds appear capable of being cleaved, thereby preventing non-specific proteolysis of folded proteins. Its proteolytic activity is essential for the survival of cells at elevated temperatures. It can degrade IciA, ada, casein, globin and PapA. DegP shares specificity with DegQ. DegP is also involved in the biogenesis of partially folded outer-membrane proteins (OMP).
Specifications for Product Family
Specifications
Specifications
- Catalog No:
- BMOL373034.20
- BMOL373034.100
- Protein/peptide name:
- DegP
- DegP
- Protein synonyms:
- htrA|Protease Do|Periplasmic serine endoprotease DegP|Heat shock protein DegP|b0161
- htrA|Protease Do|Periplasmic serine endoprotease DegP|Heat shock protein DegP|b0161
- Protein/peptide type:
- Recombinant
- Recombinant
- Sorgente luminosa:
- E. coli
- E. coli
- Coniugazione:
- Non coniugato
- Non coniugato
- ID gene:
- 947139
- 947139
- Sequenza:
- AETSSATTAQQMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGG
NGGGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIK
MADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNSGGALVNLNGELIGINTAIL
APDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIK
AGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNKGK
DQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQ - AETSSATTAQQMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGG
NGGGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIK
MADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNSGGALVNLNGELIGINTAIL
APDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIK
AGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNKGK
DQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQ
- Numero amminoacido:
- 27 - 474
- 27 - 474
- UniProtKB:
- P0C0V0
- P0C0V0
- Purezza:
- ≥90% (SDS-PAGE)
- ≥90% (SDS-PAGE)
- Formulazione:
- Supplied as a liquid in 20 mM Tris-HCl, pH 8,0, 50% glycerol
- Supplied as a liquid in 20 mM Tris-HCl, pH 8,0, 50% glycerol
- Peso molecolare:
- 48,8 kD
- 48,8 kD
- Condizioni di conservazione:
- May be stored at 4 °C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at –20 °C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- May be stored at 4 °C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at –20 °C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Temperatura di spedizione:
- 4 °C
- 4 °C
Specifications
Product Family Options
Product Information
- ConfAvailabilityPrice
- Specifications:
More
Specifications
Cat. No.BMOL373034.20Protein/peptide nameDegPProtein synonymshtrA|Protease Do|Periplasmic serine endoprotease DegP|Heat shock protein DegP|b0161Protein/peptide typeRecombinantSorgente luminosaE. coliConiugazioneNon coniugatoID gene947139SequenzaAETSSATTAQQMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGG
NGGGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIK
MADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNSGGALVNLNGELIGINTAIL
APDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIK
AGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNKGK
DQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQNumero amminoacido27 - 474UniProtKBP0C0V0Purezza≥90% (SDS-PAGE)FormulazioneSupplied as a liquid in 20 mM Tris-HCl, pH 8,0, 50% glycerolPeso molecolare48,8 kDCondizioni di conservazioneMay be stored at 4 °C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at –20 °C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.Temperatura di spedizione4 °C - Specifications:
More
Specifications
Cat. No.BMOL373034.100Protein/peptide nameDegPProtein synonymshtrA|Protease Do|Periplasmic serine endoprotease DegP|Heat shock protein DegP|b0161Protein/peptide typeRecombinantSorgente luminosaE. coliConiugazioneNon coniugatoID gene947139SequenzaAETSSATTAQQMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGG
NGGGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIK
MADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNSGGALVNLNGELIGINTAIL
APDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIK
AGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNKGK
DQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQNumero amminoacido27 - 474UniProtKBP0C0V0Purezza≥90% (SDS-PAGE)FormulazioneSupplied as a liquid in 20 mM Tris-HCl, pH 8,0, 50% glycerolPeso molecolare48,8 kDCondizioni di conservazioneMay be stored at 4 °C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at –20 °C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.Temperatura di spedizione4 °C
#: 20864.320
Supplier: VWR Chemicals
#: 83640.320
Supplier: VWR Chemicals
#: 1.00030.2500
Supplier: Merck
#: 31770.294
Supplier: VWR Chemicals
#: 1.09439.1000
Supplier: Merck