Recombinant COL11A1 (from E. coli)
NOVUNBP2-58159PEP
:
- Conf:100 µG
- Coniugazione:Non coniugato
- Protein/peptide type:Recombinant
- Sorgente luminosa:E. coli
- Specie:Human
- Numero amminoacido:DCDSSAPKAAQAQEPQIDEYAPEDIIEYDYEYGEAEYKEAESVTEGPTVTEETIAQTEANIVDDFQEYNYG
- Protein synonyms:COLL6|collagen, type XI, alpha 1|alpha-1 polypeptide
- Protein/peptide name:COL11A1
- Purezza:>80% by SDS-PAGE and Coomassie blue staining
- Formulazione:PBS and 1M Urea, pH 7.4. No Preservative
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human COL11A1.
The COL11A1 gene encodes one of the two alpha chains of type XI collagen, a minor fibrillar collagen. Type XI collagen is aheterotrimer but the third alpha chain is a post-translationally modified alpha 1 type II chain. Mutations in thisgene are associated with