Human recombinant JAMA (from HEK293 cells)
: Biorbyt
- Coniugazione:Non coniugato
- Protein/peptide type:Recombinant
- Sorgente luminosa:HEK293 cells
- Specie:Human
- Condizioni di conservazione:Store at −20 °C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 °C for 2-7 days. Aliquots of reconstituted samples are stable at −20 °C for 3 months.
- Protein synonyms:Junctional Adhesion Molecule A
- UniProtKB:Q9Y624 (Human)
- Protein/peptide name:JAMA
- Purezza:>95% as determined by reducing SDS-PAGE.
- Sequenza:SVTVHSSEPEVRIPENNPVKLSCAYSGFSSPRVEWKFDQGDTTRLVCYNNKITASYEDRVTFLPT GITFKSVTREDTGTYTCMVSEEGGNSYGEVKVKLIVLVPPSKPTVNIPSSATIGNRAVLTCSEQD GSPPSEYTWFKDGIVMPTNPKSTRAFSNSSYVLNPTTGELVFDPLSASDTGEYSCEARNGYGTPM TSNAVRMEAVERNVGVDHHHHHH
- Formulazione:Lyophilized from a 0.2 um filtered solution of 20mM TrisHCl, 50mM NaCl, 100mM Glycine, pH 7.5.
- Applicazioni testate:SDS-PAGE
Frequently Bought Together