Human recombinant IL20 (fromE. coli)
: Biorbyt
- Coniugazione:Non coniugato
- Protein/peptide type:Recombinant
- Sorgente luminosa:E. coli
- Specie:Human
- Condizioni di conservazione:Store at −20 °C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 °C for 2-7 days. Aliquots of reconstituted samples are stable at −20 °C for 3 months.
- Protein synonyms:Interleukin20
- UniProtKB:Q9NYY1 (Human)
- Protein/peptide name:IL20
- Purezza:>95% as determined by reducing SDS-PAGE.
- Sequenza:MLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLR LYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLE PQAAVVKALGELDILLQWMEETE
- Formulazione:Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
- Applicazioni testate:SDS-PAGE
Frequently Bought Together