Anticorps polyclonal de lapin anti-alpha défensine 5
ANTIA305804-100
New Product
- Type d'anticorps:Primaire
- Symbole de l'antigène:alpha Defensin 5
- Clonalité:Polyclonal
- Conjugaison:Unconjugated
- Hôte:Rabbit
- Isotype:IgG
- Réactivité:Human
- Western blot:Yes
- Environmentally Preferable:
- Formulaire:Liquid
- ID de gène:UniprotID# Q01523
- Storage buffer:Supplied in phosphate buffered saline, pH 7,3, with 50% glycerol and 0,05% proclin 300
- Molecular weight:12 kDa
- Sequence:ESLQERADEATTQKQSGEDNQDLAISFAGNGLSALRTSGSQARATCYCRTGRCATRESLSGVCEISGRLYRLCCR
- Température de stockage:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Température de transport:Shipped on blue ice at 4 °C
- Immunogène:Recombinant fusion protein containing a sequence corresponding to amino acids 20 - 94 of human DEFA5 (NP_066290.1).
- Purification:Affinity purification
- Type de conditionnement:Plastic vial
- Cdt:100 µl
Anticorps polyclonal de lapin contre la défensine alpha 5 pour WB avec des échantillons humains.
- Applications validées : WB
- Dilutions recommandées : WB : 1:500 à 1:1000
Type : Primaire
Antigène : alpha défensine 5
Clonalité : Polyclonal
Clone:
Conjugaison : Non conjugué
Épitope :
Hôte : Lapin
Isotype: IgG
Réactivité : Humain