Human Recombinant DLC8 (from E. coli)
Fournisseur: Biorbyt
Certificats
À propos de cet article
Spécifications
- Conjugaison:Unconjugated
- Type de protéine/peptide:Recombinant
- Source:E. coli
- Species:Human
- Conditions de stockage:Store at −20 °C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 °C for 2-7 days. Aliquots of reconstituted samples are stable at −20 °C for 3 months.
- Synonyme de protéine:Dynein Light Chain 1 Cytoplasmic
- Base de données UnitProt:P63167 (Human)
- Nom de la protéine/du peptide:DLC8
- Purity:>95% as determined by reducing SDS-PAGE.
- Sequence:MGSSHHHHHHSSGLVPRGSHMCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKE FDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
- Formulation:Lyophilized from a 0.2 um filtered solution of 20mM TrisHCl, 200mM NaCl, 1mM DTT, pH 8.0.
- Tested applications:SDS-PAGE
Spécifications
Frequently Bought Together