Human recombinant SUMO2 (from E. coli)
: Biorbyt
- Conjugaison:Unconjugated
- Type de protéine/peptide:Recombinant
- Source:E. coli
- Species:Human
- Conditions de stockage:Store at −20 °C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 °C for 2-7 days. Aliquots of reconstituted samples are stable at −20 °C for 3 months.
- Synonyme de protéine:Small UbiquitinRelated Modifier 2
- Base de données UnitProt:P61956 (Human)
- Nom de la protéine/du peptide:SUMO2
- Purity:>95% as determined by reducing SDS-PAGE.
- Sequence:MGSSHHHHHHSSGLVPRGSHMADEKPKEGVKTENNNHINLKVAGQDGSVVQFKIKRHTPLSKLMK AYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY
- Formulation:Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
- Tested applications:SDS-PAGE
Frequently Bought Together