Human recombinant LR3IGFI (from E. coli)
: Biorbyt
- Conjugaison:Unconjugated
- Type de protéine/peptide:Recombinant
- Source:E. coli
- Species:Human
- Conditions de stockage:Store at −20 °C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 °C for 2-7 days. Aliquots of reconstituted samples are stable at −20 °C for 3 months.
- Activité biologique:ED50 is greater than 200 ng/ml as determined by an IGF binding protein assay.
- Synonyme de protéine:InsulinLike Growth Factor I
- Base de données UnitProt:P05019 (Human)
- Nom de la protéine/du peptide:LR3IGFI
- Purity:>95% as determined by reducing SDS-PAGE.
- Sequence:MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSC DLRRLEMYCAPLKPAKSA
- Formulation:Lyophilized from a 0.2 um filtered solution of 300mM HAc-NaAc, pH 6.5.
- Tested applications:SDS-PAGE , FuncS
Frequently Bought Together