Human recombinant IFN alpha 2a (from E. coli)
: Biorbyt
- Conjugaison:Unconjugated
- Type de protéine/peptide:Recombinant
- Source:E. coli
- Species:Human
- Conditions de stockage:Store at −20 °C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 °C for 2-7 days. Aliquots of reconstituted samples are stable at −20 °C for 3 months.
- Activité biologique:Specific Activity is greater than 1.0 x 108 IU/ mg as determined in a viral resistance assay using VSVWISH cells.
- ID de gène:3440
- Synonyme de protéine:Interferon Alpha2
- Base de données UnitProt:P01563 (Human)
- Nom de la protéine/du peptide:IFN alpha 2a
- Purity:>95% as determined by reducing SDS-PAGE.
- Sequence:MCDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIF NLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLY LKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
- Formulation:Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
- Tested applications:SDS-PAGE , FuncS
Frequently Bought Together