Anti-Peroxiredoxin 5 Rabbit Monoclonal Antibody [Clone: ARC0873]
Catalog # ANTIA305523-100
Supplier: ANTIBODIES.COM
New Product
Specifications
- Antibody type:Primary
- Antigen name:ACR1
- Antigen symbol:Peroxiredoxin 5
- Clonality:Monoclonal
- Clone:ARC0873
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# P30044
- Antigen synonyms:HEL-S-55|Liver tissue 2D-page spot 71B|Peroxiredoxin 5|Antioxidant enzyme B166|Alu co repressor 1|AOEB166|Alu corepressor 1|mitochondrial|epididymis secretory protein Li 55
- Storage buffer:Supplied in phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:17 kDa
- Sequence:CSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGT
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 100 - 200 of human Peroxiredoxin 5 (PRDX5) (PRDX5) (P30044).
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit monoclonal [ARC0873] antibody to Peroxiredoxin 5 for WB with samples derived from human, mouse and rat.
- Validated applications: WB
- Recommended dilutions: WB: 1:500 to 1:2000
Type: Primary
Antigen: Peroxiredoxin 5
Clonality: Monoclonal
Clone: ARC0873
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat