Human recombinant ASGPR1 (from HEK293 cells)
: Biorbyt
- Conjugation:Unconjugated
- Protein/peptide type:Recombinant
- Source:HEK293 cells
- Species:Human
- Storage conditions:Store at −20 °C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 °C for 2-7 days. Aliquots of reconstituted samples are stable at −20 °C for 3 months.
- Protein synonyms:ASGPR 1|C-Type Lectin Domain Family 4 Member H1|HL-1|ASGR1|CLEC4H1|Hepatic Lectin H1|Asialoglycoprotein Receptor 1|ASGP-R 1
- UniProtKB:P07306 (Human)
- Protein/peptide name:ASGPR1
- Purity:>95% as determined by reducing SDS-PAGE.
- Sequence:QNSQLQEELRGLRETFSNFTASTEAQVKGLSTQGGNVGRKMKSLESQLEKQQKDLSEDHSSLLLH VKQFVSDLRSLSCQMAALQGNGSERTCCPVNWVEHERSCYWFSRSGKAWADADNYCRLEDAHLVV VTSWEEQKFVQHHIGPVNTWMGLHDQNGPWKWVDGTDYETGFKNWRPEQPDDWYGHGLGGGEDCA HFTDDGRWNDDVCQRPYRWVCETELDKASQEPPLLVDHHHHHH
- Formulation:Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
- Tested applications:SDS-PAGE
Frequently Bought Together