Anti-TIMP2 Mouse Monoclonal Antibody [clone: 4F5]
Catalog # ABNOH00007077-M02
Supplier: Abnova
Specifications
- Antibody type:Primary
- Antigen name:Tissue inhibitor of metalloproteinases 2
- Antigen symbol:TIMP2
- Clonality:Monoclonal
- Clone:4F5
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- Isotype:IgG2a kappa
- Reactivity:Human
- Western blot:Yes
- Cross adsorption:No
- Format:Liquid
- Gene ID:7077
- Antigen synonyms:tissue inhibitor of metalloproteinases 2|metalloproteinase inhibitor 2|TIMP-2|tissue inhibitor of metalloproteinase 2
- Amino acid number:27 to 220
- Storage buffer:1x PBS, pH 7,4
- Sequence:CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP
- Storage temperature:Store at –20 °C or lower. Aliquot to avoid repeated freezing and thawing.
- Immunogen:TIMP2 (AAH52605, 27 a.a. ~ 220 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Size:100 µg
- Pk:100 µg
Specifications
About this item
Mouse monoclonal antibody raised against a full-length recombinant TIMP2.
Recommended Dilutions: Western Blot: 1-5 ?g/ml
Type: Primary
Antigen: TIMP2
Clonality: Monoclonal
Clone: 4F5
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a kappa
Reactivity: Human