Anti-GAMT Rabbit Polyclonal Antibody
ORIGTA329508
: OriGene
- Antibody type:Primary
- Antigen symbol:GAMT
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western blot:Yes
- Cross adsorption:No
- Form:Liquid
- Storage buffer:Lyophilized powder. Add 50 ul of distilled water. Final anti-GAMT antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
- Molecular weight:29 kDa
- Sequence:PGEGPFLTPWVGWTVLVHLEIKVLCLAQWLPGAVAQVYNPSTVEGRGGQI
- Storage temperature:–20 °C
- Shipping temperature:–20 °C
- Immunogen:The immunogen for anti-GAMT antibody: synthetic peptide directed towards the middle region of human GAMT. Synthetic peptide located within the following region: PGEGPFLTPWVGWTVLVHLEIKVLCLAQWLPGAVAQVYNPSTVEGRGGQI
- Size:50 μg
- Pk:50 µG
Type: Primary
Antigen: GAMT
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human