Anti-MST4 Rabbit Monoclonal Antibody [clone: ARC2953]
ANTIA305762-100
New Product
- Antikörper-Typ:Primär
- Antigen-Name:2610018G03Rik
- Antigen-Symbol:MST4
- Klonalität:Monoklonal
- Klon:ARC2953
- Konjugation:Unconjugated
- Wirt:Rabbit
- Isotyp:IgG
- Reaktivität:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gen-ID:UniprotID# Q9P289
- Antigen-Synonyme:MASK|Mammalian sterile 20 like 4|Mst3 and SOK1-related kinase|MST-4|EC 2.7.11.1|Mammalian STE20-like protein kinase 4|Mammalian Ste20 like protein kinase 4|MST3 and SOK1 related kinase|MST 4
- Lagerungspuffer:Supplied in phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:52 kDa
- Sequence:ENNTHPEWSFTTVRKKPDPKKVQNGAEQDLVQTLSCLSMIITPAFAELKQQDENNASRNQAIEELEKSIAVAEAACPGITDKMVKKLIEKFQKCSADESP
- Lagertemperatur:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Transporttemperatur:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 317 - 416 of human MST4 (Q9P289).
- Reinigung:Affinity purification
- Packung:Plastic vial
- VE:100 µl
Rabbit monoclonal [ARC2953] antibody to MST4 for WB with samples derived from human, mouse and rat.
- Validated applications: WB
- Recommended dilutions: WB: 1:500 to 1:1000
Type: Primary
Antigen: MST4
Clonality: Monoclonal
Clone: ARC2953
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat