Recombinant DegP from E. coli
Über diesen Artikel
DegP acts as a chaperone at low temperatures but switches to a peptidase (heat shock protein) at higher temperatures. It degrades transiently denatured and unfolded proteins which accumulate in the periplasm following heat shock or other stress conditions.
- Recombinant protein corresponding to aa 27 - 474 from E. coli degP, fused to His-Tag at N-terminal, expressed in Yeast
DegP is efficient with Val-Xaa and Ile-Xaa peptide bonds, suggesting a preference for beta-branched side chain amino acids. Only unfolded proteins devoid of disulfide bonds appear capable of being cleaved, thereby preventing non-specific proteolysis of folded proteins. Its proteolytic activity is essential for the survival of cells at elevated temperatures. It can degrade IciA, ada, casein, globin and PapA. DegP shares specificity with DegQ. DegP is also involved in the biogenesis of partially folded outer-membrane proteins (OMP).
2 Varianten
Product Details & Documents
DegP acts as a chaperone at low temperatures but switches to a peptidase (heat shock protein) at higher temperatures. It degrades transiently denatured and unfolded proteins which accumulate in the periplasm following heat shock or other stress conditions.
- Recombinant protein corresponding to aa 27 - 474 from E. coli degP, fused to His-Tag at N-terminal, expressed in Yeast
DegP is efficient with Val-Xaa and Ile-Xaa peptide bonds, suggesting a preference for beta-branched side chain amino acids. Only unfolded proteins devoid of disulfide bonds appear capable of being cleaved, thereby preventing non-specific proteolysis of folded proteins. Its proteolytic activity is essential for the survival of cells at elevated temperatures. It can degrade IciA, ada, casein, globin and PapA. DegP shares specificity with DegQ. DegP is also involved in the biogenesis of partially folded outer-membrane proteins (OMP).
Spezifikationen für diese Produktfamilie
Technische Daten
Technische Daten
- Catalog No:
- BMOL373034.20
- BMOL373034.100
- Protein/Peptid-Name:
- DegP
- DegP
- Proteinsynonym:
- htrA|Protease Do|Periplasmic serine endoprotease DegP|Heat shock protein DegP|b0161
- htrA|Protease Do|Periplasmic serine endoprotease DegP|Heat shock protein DegP|b0161
- Protein/Peptid-Typ:
- Rekombinant
- Rekombinant
- Ursprung:
- E. coli
- E. coli
- Konjugation:
- Unconjugated
- Unconjugated
- Gen-ID:
- 947139
- 947139
- Sequence:
- AETSSATTAQQMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGG
NGGGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIK
MADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNSGGALVNLNGELIGINTAIL
APDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIK
AGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNKGK
DQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQ - AETSSATTAQQMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGG
NGGGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIK
MADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNSGGALVNLNGELIGINTAIL
APDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIK
AGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNKGK
DQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQ
- Aminosäurezahl:
- 27 - 474
- 27 - 474
- UniProtKB:
- P0C0V0
- P0C0V0
- Purity:
- ≥90% (SDS-PAGE)
- ≥90% (SDS-PAGE)
- Zusammensetzung:
- Supplied as a liquid in 20 mM Tris-HCl, pH 8,0, 50% glycerol
- Supplied as a liquid in 20 mM Tris-HCl, pH 8,0, 50% glycerol
- Molekulargewicht:
- 48,8 kD
- 48,8 kD
- Lagerbedingungen:
- May be stored at 4 °C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at –20 °C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- May be stored at 4 °C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at –20 °C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Transporttemperatur:
- 4 °C
- 4 °C
Technische Daten
Product Family Options
Produktinformationen
- VEVerfügbarkeitPreis
- Spezifikationen:
Mehr
Specifications
Cat. No.BMOL373034.20Protein/Peptid-NameDegPProteinsynonymhtrA|Protease Do|Periplasmic serine endoprotease DegP|Heat shock protein DegP|b0161Protein/Peptid-TypRekombinantUrsprungE. coliKonjugationUnconjugatedGen-ID947139SequenceAETSSATTAQQMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGG
NGGGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIK
MADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNSGGALVNLNGELIGINTAIL
APDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIK
AGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNKGK
DQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQAminosäurezahl27 - 474UniProtKBP0C0V0Purity≥90% (SDS-PAGE)ZusammensetzungSupplied as a liquid in 20 mM Tris-HCl, pH 8,0, 50% glycerolMolekulargewicht48,8 kDLagerbedingungenMay be stored at 4 °C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at –20 °C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.Transporttemperatur4 °C - Spezifikationen:
Mehr
Specifications
Cat. No.BMOL373034.100Protein/Peptid-NameDegPProteinsynonymhtrA|Protease Do|Periplasmic serine endoprotease DegP|Heat shock protein DegP|b0161Protein/Peptid-TypRekombinantUrsprungE. coliKonjugationUnconjugatedGen-ID947139SequenceAETSSATTAQQMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGG
NGGGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIK
MADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNSGGALVNLNGELIGINTAIL
APDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIK
AGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNKGK
DQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQAminosäurezahl27 - 474UniProtKBP0C0V0Purity≥90% (SDS-PAGE)ZusammensetzungSupplied as a liquid in 20 mM Tris-HCl, pH 8,0, 50% glycerolMolekulargewicht48,8 kDLagerbedingungenMay be stored at 4 °C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at –20 °C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.Transporttemperatur4 °C
#: 20864.320
Anbieter: VWR Chemicals
#: 83640.320
Anbieter: VWR Chemicals
#: 1.00030.2500
Anbieter: Merck
#: 31770.294
Anbieter: VWR Chemicals
#: 83645.320
Anbieter: VWR Chemicals
#: 1.09439.1000
Anbieter: Merck