Human recombinant WBP2 (from E. coli)
Marketsource
Anbieter: Biorbyt
Über diesen Artikel
3 Varianten
Product Details & Documents
Documents
orb49743
Datasheet
Spezifikationen für diese Produktfamilie
Technische Daten
Technische Daten
- Catalog No:
- BIRBORB49743-10
- BIRBORB49743-50
- BIRBORB49743-1
- Protein/Peptid-Name:
- WBP2
- WBP2
- WBP2
- Proteinsynonym:
- WW DomainBinding 2
- WW DomainBinding 2
- WW DomainBinding 2
- Protein/Peptid-Typ:
- Rekombinant
- Rekombinant
- Rekombinant
- Spezies:
- Human
- Human
- Human
- Ursprung:
- E. coli
- E. coli
- E. coli
- Konjugation:
- Unconjugated
- Unconjugated
- Unconjugated
- Sequence:
- MGSSHHHHHHSSGLVPRGSHMALNKNHSEGGGVIVNNTESILMSYDHVELTFNDMKNVPEAFKGT KKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQPVFGANYIKGTVKAEA
- MGSSHHHHHHSSGLVPRGSHMALNKNHSEGGGVIVNNTESILMSYDHVELTFNDMKNVPEAFKGT KKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQPVFGANYIKGTVKAEA
- MGSSHHHHHHSSGLVPRGSHMALNKNHSEGGGVIVNNTESILMSYDHVELTFNDMKNVPEAFKGT KKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQPVFGANYIKGTVKAEA
- UniProtKB:
- Q969T9 (Human)
- Q969T9 (Human)
- Q969T9 (Human)
- Purity:
- >95% as determined by reducing SDS-PAGE.
- >95% as determined by reducing SDS-PAGE.
- >95% as determined by reducing SDS-PAGE.
- Zusammensetzung:
- Lyophilized from a 0.2 um filtered solution of 20mM TrisHCl, 1mM DTT, pH 8.0.
- Lyophilized from a 0.2 um filtered solution of 20mM TrisHCl, 1mM DTT, pH 8.0.
- Lyophilized from a 0.2 um filtered solution of 20mM TrisHCl, 1mM DTT, pH 8.0.
- Lagerbedingungen:
- Store at −20 °C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 °C for 2-7 days. Aliquots of reconstituted samples are stable at −20 °C for 3 months.
- Store at −20 °C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 °C for 2-7 days. Aliquots of reconstituted samples are stable at −20 °C for 3 months.
- Store at −20 °C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 °C for 2-7 days. Aliquots of reconstituted samples are stable at −20 °C for 3 months.
- Validierte Anwendungen:
- SDS-PAGE
- SDS-PAGE
- SDS-PAGE
Technische Daten
Product Family Options
Produktinformationen
- VEVerfügbarkeitPreis
- Spezifikationen:Marketsource
Mehr
Specifications
Cat. No.BIRBORB49743-10Protein/Peptid-NameWBP2ProteinsynonymWW DomainBinding 2Protein/Peptid-TypRekombinantSpeziesHumanUrsprungE. coliKonjugationUnconjugatedSequenceMGSSHHHHHHSSGLVPRGSHMALNKNHSEGGGVIVNNTESILMSYDHVELTFNDMKNVPEAFKGT KKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQPVFGANYIKGTVKAEAUniProtKBQ969T9 (Human)Purity>95% as determined by reducing SDS-PAGE.ZusammensetzungLyophilized from a 0.2 um filtered solution of 20mM TrisHCl, 1mM DTT, pH 8.0.LagerbedingungenStore at −20 °C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 °C for 2-7 days. Aliquots of reconstituted samples are stable at −20 °C for 3 months.Validierte AnwendungenSDS-PAGEMarketsource - Spezifikationen:Marketsource
Mehr
Specifications
Cat. No.BIRBORB49743-50Protein/Peptid-NameWBP2ProteinsynonymWW DomainBinding 2Protein/Peptid-TypRekombinantSpeziesHumanUrsprungE. coliKonjugationUnconjugatedSequenceMGSSHHHHHHSSGLVPRGSHMALNKNHSEGGGVIVNNTESILMSYDHVELTFNDMKNVPEAFKGT KKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQPVFGANYIKGTVKAEAUniProtKBQ969T9 (Human)Purity>95% as determined by reducing SDS-PAGE.ZusammensetzungLyophilized from a 0.2 um filtered solution of 20mM TrisHCl, 1mM DTT, pH 8.0.LagerbedingungenStore at −20 °C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 °C for 2-7 days. Aliquots of reconstituted samples are stable at −20 °C for 3 months.Validierte AnwendungenSDS-PAGEMarketsource - Spezifikationen:Marketsource
Mehr
Specifications
Cat. No.BIRBORB49743-1Protein/Peptid-NameWBP2ProteinsynonymWW DomainBinding 2Protein/Peptid-TypRekombinantSpeziesHumanUrsprungE. coliKonjugationUnconjugatedSequenceMGSSHHHHHHSSGLVPRGSHMALNKNHSEGGGVIVNNTESILMSYDHVELTFNDMKNVPEAFKGT KKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQPVFGANYIKGTVKAEAUniProtKBQ969T9 (Human)Purity>95% as determined by reducing SDS-PAGE.ZusammensetzungLyophilized from a 0.2 um filtered solution of 20mM TrisHCl, 1mM DTT, pH 8.0.LagerbedingungenStore at −20 °C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 °C for 2-7 days. Aliquots of reconstituted samples are stable at −20 °C for 3 months.Validierte AnwendungenSDS-PAGEMarketsource
Recommendations
Recommendations will be personalized based on your shopping preferences only if you have given your consent by enabling "Enhance my Shopping Experience" on the "Personal Info page".
Otherwise, you will receive generic recommendations.



