Human recombinant SCF (from E. coli)
: Biorbyt
- Konjugation:Unconjugated
- Protein/Peptid-Typ:Rekombinant
- Ursprung:E. coli
- Spezies:Human
- Lagerbedingungen:Store at −20 °C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 °C for 2-7 days. Aliquots of reconstituted samples are stable at −20 °C for 3 months.
- Biologische Aktivität:ED50 is less than 2 ng/ml as determined by the dosedependent stimulation of Human TF1 cells.
Specific Activity of 5.0 x 105 IU/mg. - Proteinsynonym:Kit Ligand
- UniProtKB:P21583 (Human)
- Protein/Peptid-Name:SCF
- Purity:>95% as determined by reducing SDS-PAGE.
- Sequence:MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFS NISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDF VVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA
- Zusammensetzung:Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.0.
- Validierte Anwendungen:SDS-PAGE , FuncS
Frequently Bought Together