Human recombinant ProNGF (from E. coli)
Marketsource
: Biorbyt
- Catalog No:
- BIRBORB49601-10
- BIRBORB49601-50
- BIRBORB49601-1
- Protein/Peptid-Name:
- ProNGF
- ProNGF
- ProNGF
- Proteinsynonym:
- BetaNerve Growth Factor
- BetaNerve Growth Factor
- BetaNerve Growth Factor
- Protein/Peptid-Typ:
- Rekombinant
- Rekombinant
- Rekombinant
- Spezies:
- Human
- Human
- Human
- Ursprung:
- E. coli
- E. coli
- E. coli
- Konjugation:
- Unconjugated
- Unconjugated
- Unconjugated
- Sequence:
- MEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRL RSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKT TATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALT MDGKQAAWRFIRIDTACVCVLSRKAVRRA
- MEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRL RSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKT TATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALT MDGKQAAWRFIRIDTACVCVLSRKAVRRA
- MEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRL RSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKT TATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALT MDGKQAAWRFIRIDTACVCVLSRKAVRRA
- UniProtKB:
- P01138 (Human)
- P01138 (Human)
- P01138 (Human)
- Purity:
- >95% as determined by reducing SDS-PAGE.
- >95% as determined by reducing SDS-PAGE.
- >95% as determined by reducing SDS-PAGE.
- Zusammensetzung:
- Lyophilized from a 0.2 um filtered solution of 20mM PB, 250mM NaCl, pH 7.2.
- Lyophilized from a 0.2 um filtered solution of 20mM PB, 250mM NaCl, pH 7.2.
- Lyophilized from a 0.2 um filtered solution of 20mM PB, 250mM NaCl, pH 7.2.
- Lagerbedingungen:
- Store at −20 °C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 °C for 2-7 days. Aliquots of reconstituted samples are stable at −20 °C for 3 months.
- Store at −20 °C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 °C for 2-7 days. Aliquots of reconstituted samples are stable at −20 °C for 3 months.
- Store at −20 °C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 °C for 2-7 days. Aliquots of reconstituted samples are stable at −20 °C for 3 months.
- Validierte Anwendungen:
- SDS-PAGE
- SDS-PAGE
- SDS-PAGE
Product Family Options
- VE
- Marketsource
Specifications
Cat. No.BIRBORB49601-10Protein/Peptid-NameProNGFProteinsynonymBetaNerve Growth FactorProtein/Peptid-TypRekombinantSpeziesHumanUrsprungE. coliKonjugationUnconjugatedSequenceMEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRL RSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKT TATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALT MDGKQAAWRFIRIDTACVCVLSRKAVRRAUniProtKBP01138 (Human)Purity>95% as determined by reducing SDS-PAGE.ZusammensetzungLyophilized from a 0.2 um filtered solution of 20mM PB, 250mM NaCl, pH 7.2.LagerbedingungenStore at −20 °C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 °C for 2-7 days. Aliquots of reconstituted samples are stable at −20 °C for 3 months.Validierte AnwendungenSDS-PAGEMarketsource - Marketsource
Specifications
Cat. No.BIRBORB49601-50Protein/Peptid-NameProNGFProteinsynonymBetaNerve Growth FactorProtein/Peptid-TypRekombinantSpeziesHumanUrsprungE. coliKonjugationUnconjugatedSequenceMEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRL RSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKT TATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALT MDGKQAAWRFIRIDTACVCVLSRKAVRRAUniProtKBP01138 (Human)Purity>95% as determined by reducing SDS-PAGE.ZusammensetzungLyophilized from a 0.2 um filtered solution of 20mM PB, 250mM NaCl, pH 7.2.LagerbedingungenStore at −20 °C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 °C for 2-7 days. Aliquots of reconstituted samples are stable at −20 °C for 3 months.Validierte AnwendungenSDS-PAGEMarketsource - Marketsource
Specifications
Cat. No.BIRBORB49601-1Protein/Peptid-NameProNGFProteinsynonymBetaNerve Growth FactorProtein/Peptid-TypRekombinantSpeziesHumanUrsprungE. coliKonjugationUnconjugatedSequenceMEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRL RSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKT TATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALT MDGKQAAWRFIRIDTACVCVLSRKAVRRAUniProtKBP01138 (Human)Purity>95% as determined by reducing SDS-PAGE.ZusammensetzungLyophilized from a 0.2 um filtered solution of 20mM PB, 250mM NaCl, pH 7.2.LagerbedingungenStore at −20 °C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 °C for 2-7 days. Aliquots of reconstituted samples are stable at −20 °C for 3 months.Validierte AnwendungenSDS-PAGEMarketsource



