Human recombinant APBA3 (from E. coli)
Anbieter: Biorbyt
Zertifikate
Über diesen Artikel
Technische Daten
- Konjugation:Unconjugated
- Protein/Peptid-Typ:Rekombinant
- Ursprung:E. coli
- Spezies:Human
- Lagerbedingungen:Store at −20 °C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 °C for 2-7 days. Aliquots of reconstituted samples are stable at −20 °C for 3 months.
- Proteinsynonym:Amyloid Beta A4 PrecursorBinding Family A Member 3
- UniProtKB:O96018 (Human)
- Protein/Peptid-Name:APBA3
- Purity:>95% as determined by reducing SDS-PAGE.
- Sequence:MDFPTISRSPSGPPAMDLEGPRDILVPSEDLTPDSQWDPMPGGPGSLSRMELDESSLQELVQQFE ALPGDLVGPSPGGAPCPLHIATGHGLASQEIADAHGLLSAEAGRDDLLGLLHCEECPPSQTGPEE PLEPAPRLLEHHHHHH
- Zusammensetzung:Lyophilized from a 0.2 um filtered solution of 20mM PB ,150mM NaCl, pH 7.2.
- Validierte Anwendungen:SDS-PAGE
Technische Daten
Frequently Bought Together