Anti-KDM1/LSD1 Rabbit Monoclonal Antibody [clone: ARC1160]
Rabbit monoclonal [ARC1160] antibody to KDM1/LSD1 for WB and IHC with samples derived from Human.
- Validated Applications: WB, IHC
- Recommended Dilutions: WB: 1:500 to 1:1,000, IHC: 1:50 to 1:200
Type: Primary
Antigen: KDM1 / LSD1
Clonality: Monoclonal
Clone: ARC1160
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human
- Catalog No:
- 77217-850
- Antigen symbol:
- KDM1 / LSD1
- Antigen name:
- Amine oxidase (flavin containing) domain 2
- Antigen synonyms:
- EC1|BHC110|BRAF35-HDAC complex protein BHC110|BRAF35 HDAC complex protein BHC110|CPRF|AOF2|Amine oxidase, flavin containing, 2|FAD binding protein BRAF35 HDAC complex, 110 kDa subunit|BRAF35/HDAC complex, 110-kD subunit
- Antibody type:
- Primary
- Clonality:
- Monoclonal
- Conjugation:
- Unconjugated
- Clone:
- ARC1160
- Reactivity:
- Human
- Host:
- Rabbit
- Gene ID:
- UniprotID# O60341
- Isotype:
- IgG
- Western blot:
- Yes
- ImmunoChemistry:
- Yes
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 700-811 of human KDM1/LSD1 (O60341).
- Sequence:
- APILLALVAGEAAGIMENISDDVIVGRCLAILKGIFGSSAVPQPKETVVSRWRADPWARGSYSYVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATV
- Form:
- Liquid
- Molecular weight:
- 110 kDa
- Purification:
- Affinity purification
- Storage buffer:
- Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide
- Storage temperature:
- Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:
- Shipped on blue ice at 4 °C
- Tested applications:
- IHC
Frequently Bought Together
VWR® Light-Duty Tissue Wipers
: VWR International
VWR® Nitrile Examination Gloves, Blue
: VWR International
VWR® Disposable Petri Dishes
: VWR International
VWR® Universal Pipette Tips
: VWR International
VWR® Microcentrifuge Tubes, PP
: VWR International