Anti-NIPSNAP1 Rabbit Polyclonal Antibody
Rabbit polyclonal antibody to NIPSNAP1 for WB with samples derived from Human, Mouse and Rat.
- Validated Applications: WB
- Recommended Dilutions: WB: 1:500 to 1:1,000
Type: Primary
Antigen: NIPSNAP1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat
- Catalog No:
- 77204-892
- Antigen symbol:
- NIPSNAP1
- Antigen name:
- NIPSNAP 1
- Antigen synonyms:
- Protein NipSnap homolog 1|Nipsnap homolog 1 (C. elegans)|NIPSNAP1
- Antibody type:
- Primary
- Clonality:
- Polyclonal
- Conjugation:
- Unconjugated
- Reactivity:
- Human, Rat, Mouse
- Host:
- Rabbit
- Gene ID:
- UniprotID# Q9BPW8
- Isotype:
- IgG
- Western blot:
- Yes
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 70-145 of human NIPSNAP1 (NP_003625.2)
- Sequence:
- NLYKIQFHNVKPEYLDAYNSLTEAVLPKLHLDEDYPCSLVGNWNTWYGEQDQAVHLWRFSGGYPALMDCMNKLKNN
- Form:
- Liquid
- Molecular weight:
- 29 kDa
- Purification:
- Affinity purification
- Storage buffer:
- Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300
- Storage temperature:
- Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:
- Shipped on blue ice at 4 °C
Frequently Bought Together
VWR® Disposable Petri Dishes
: VWR International
VWR® Nitrile Examination Gloves, Blue
: VWR International
VWR® Light-Duty Tissue Wipers
: VWR International
VWR® Universal Pipette Tips
: VWR International
VWR® Microcentrifuge Tubes, PP
: VWR International