Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/ca/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
- Conjugation:Unconjugated
- Species:Pig
- Size:1 mg
- Storage conditions:–20 °C
- Protein synonyms:Big Endothelin 1 porcine|Endothelin (1-39)|Big Endothelin 1
- Protein/peptide name:Big Endothelin 1 (1-39)
- Purity:95%
- Molecular weight:4384.1 Da
- Sequence:CSCSSLMDKECVYFCHLDIIWVNTPEHIVPYGLGSPSRS (Disulfide bridge: 1-15 and 3-11)
- Cat. no.:102996-096
- Supplier No.:AS-20715
This is a 38 residue inactive big endothelin-1 intermediate that gives rise to a shorter active peptide produced in vascular endothelial cells.
Sequence:CSCSSLMDKECVYFCHLDIIWVNTPEHIVPYGLGSPSRS (Disulfide bridge: 1-15 and 3-11)
MW:4384.1 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C