Order Entry
Canada
ContactUsLinkComponent
1007 results for "peptide synthesis"

1007 Results for: "peptide synthesis"

Sort By
Anti-ACSS3 Rabbit Polyclonal Antibody

Anti-ACSS3 Rabbit Polyclonal Antibody

Supplier: Proteintech

ACSS3(acyl-CoA synthetase short-chain family member 3, mitochondrial) belongs to the ATP-dependent AMP-binding enzyme family. It activates acetate so that it can be used for lipid synthesis or for energy generation. The deduced 686-amino acid protein contains 4 of 5 motifs characteristic of acyl-CoA synthetases. This protein has 2 isoforms produced by alternative splicing. The full length protein has a transit peptide with 29 amino acids.

Expand 1 Items
Loading...
Anti-NAA10 Rabbit Polyclonal Antibody

Anti-NAA10 Rabbit Polyclonal Antibody

Supplier: Prosci

N-alpha-acetylation is one of the most common protein modifications that occurs during protein synthesis and involves the transfer of an acetyl group from acetyl-coenzyme A to the protein alpha-amino group. ARD1A, together with NATH (NARG1; MIM 608000), is part of a major N-alpha-acetyltransferase complex responsible for alpha-acetylation of proteins and peptides.N-alpha-acetylation is one of the most common protein modifications that occurs during protein synthesis and involves the transfer of an acetyl group from acetyl-coenzyme A to the protein alpha-amino group. ARD1A, together with NATH (NARG1; MIM 608000), is part of a major N-alpha-acetyltransferase complex responsible for alpha-acetylation of proteins and peptides (Sanchez-Puig and Fersht, 2006 [PubMed 16823041]).

Expand 1 Items
Loading...

Human/Mouse Recombinant TGF-β 3 (Animal free) (from E. coli)

Supplier: FUJIFILM IRVINE SCIENTIFIC, INC

Transforming growth factors (TGFs) are multifunctional peptides that regulate growth and differentiation in most cell types. The TGF-β family of proteins signal through serine/threonine kinase receptors. TGF-β isoforms (TGF-β1, -β2, and –β3) have overlapping, yet distinct biological actions in developing and adult tissues. TGF-β3 is an important factor in regulating cell adhesion and accelerating wound repair. TGF-β3 also functions during osteoblast proliferation, chemotaxis, and collagen synthesis.

Expand 4 Items
Loading...

Human/Mouse Recombinant TGF-B 3 (from E. coli)

Supplier: FUJIFILM IRVINE SCIENTIFIC, INC

Transforming growth factors (TGFs) are multifunctional peptides that regulate growth and differentiation in most cell types. The TGF-β family of proteins signal through serine/threonine kinase receptors. TGF-β isoforms (TGF-β1, -β2, and –β3) have overlapping, yet distinct biological actions in developing and adult tissues. TGF-β3 is an important factor in regulating cell adhesion and accelerating wound repair. TGF-β3 also functions during osteoblast proliferation, chemotaxis, and collagen synthesis.

Expand 4 Items
Loading...

Human/Mouse Recombinant TGF-B 3 (from E. coli)

Supplier: FUJIFILM IRVINE SCIENTIFIC, INC

Transforming growth factors (TGFs) are multifunctional peptides that regulate growth and differentiation in most cell types. The TGF-β family of proteins signal through serine/threonine kinase receptors. TGF-β isoforms (TGF-β1, -β2, and –β3) have overlapping, yet distinct biological actions in developing and adult tissues. TGF-β3 is an important factor in regulating cell adhesion and accelerating wound repair. TGF-β3 also functions during osteoblast proliferation, chemotaxis, and collagen synthesis.

Expand 4 Items
Loading...

Bovine;Human;Pig Glucagon (1-29)

Supplier: Anaspec Inc

Glucagon is a peptide hormone secreted from the pancreatic Islet of Langerhans alpha-cells, in response to low circulating blood glucose levels in order to restore normal glucose levels. It acts on hepatic enzymes that regulate glucose production and glycogen synthesis. Excessive amounts of circulating glucagon levels is implicated in the metabolic dysregulation of type 2 diabetes, since such conditions result in hyperglycemia.
Sequence: HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
MW: 3482.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Expand 2 Items
Loading...

Tricyclic amide linker resin (DL-form) 200-400 mesh

Supplier: Bachem Americas

Ramage resin is highly suitable for the preparation of peptide amides by the Fmoc-strategy and is recommended for C-terminal Phe, Tyr and Ile. Cleavage has been performed with 50 % TFA in CH₂Cl₂ or 95% aqueous TFA. Scavengers may be required. Tricyclic amide linker resin has been used for the synthesis of fluorogenic substrates for continuous assay of aminopeptidase P. Bachem additionally offers the Ramage amide linker (Q-2745) to be coupled to other types of carrier resin.

Expand 2 Items
Loading...

Human/Mouse Recombinant TGF-β 3 (from E. coli)

Supplier: FUJIFILM IRVINE SCIENTIFIC, INC

Transforming growth factors (TGFs) are multifunctional peptides that regulate growth and differentiation in most cell types. The TGF-β family of proteins signal through serine/threonine kinase receptors. TGF-β isoforms (TGF-β1, -β2, and –β3) have overlapping, yet distinct biological actions in developing and adult tissues. TGF-β3 is an important factor in regulating cell adhesion and accelerating wound repair. TGF-β3 also functions during osteoblast proliferation, chemotaxis, and collagen synthesis.

Expand 4 Items
Loading...

Prosaptide TX14(A) Peptide

Supplier: Anaspec Inc

This 14-mer prosaptide sequence is derived from the active neurotrophic region in the amino-terminal portion of the saposin C domain. Synthetic peptides derived from this region are biologically active and are named “prosaptides.” Prosaposin and prosaptides are active on a variety of neuronal cells, stimulating sulfatide synthesis and increasing sulfatide concentration in Schwann cells and oligodendrocytes. This indicates that prosaposin and prosaptides are trophic factors for myelin formation.
Sequence:TaLIDNNATEEILY
MW:1579.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 2 Items
Loading...

Anti-GHRL Mouse Monoclonal Antibody [clone: Ghr5]

Supplier: Genetex

Ghrelin is an endogenous ligand for the growth hormone secretagogue receptor and is involved in regulating growth hormone release from the pituitary. It has an appetite stimulating effect, induces adiposity, and stimulates gastric acid secretion, and it is involved in growth regulation. Ghrelin is synthesized as a preprohormone, then proteolytically processed to yield a 28 amino acid peptide. An interesting and unique modification is imposed on the hormone during synthesis in the form of an n octanoic acid bound to one of its amino acids. This modification is necessary for biologic activity.

Expand 1 Items
Loading...
Anti-GHRL Chicken Polyclonal Antibody

Anti-GHRL Chicken Polyclonal Antibody

Supplier: Genetex

Ghrelin is an endogenous ligand for the growth hormone secretagogue receptor and is involved in regulating growth hormone release from the pituitary. It has an appetite stimulating effect, induces adiposity, and stimulates gastric acid secretion, and it is involved in growth regulation. Ghrelin is synthesized as a preprohormone, then proteolytically processed to yield a 28 amino acid peptide. An interesting and unique modification is imposed on the hormone during synthesis in the form of an n octanoic acid bound to one of its amino acids. This modification is necessary for biologic activity.

Expand 1 Items
Loading...

(D-2-Nal⁶)-LHRH Acetate

Supplier: Bachem Americas

LHRH is also called Gonadotropin-Releasing Hormone (GnRH) or Luteinizing Hormone-Releasing Factor (LRF).

Expand 2 Items
Loading...

Bovine;Human;Pig Biotin-Glucagon (1-29)

Supplier: Anaspec Inc

This is N-terminal biotin labeled Glucagon (1-29). Glucagon is a peptide hormone secreted from the pancreatic Islet of Langerhans alpha-cells, in response to low circulating blood glucose levels in order to restore normal glucose levels. It acts on hepatic enzymes that regulate glucose production and glycogen synthesis. Excessive amounts of circulating glucagon levels is implicated in the metabolic dysregulation of type 2 diabetes, since such conditions result in hyperglycaemia.
Sequence: Biotin-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
MW: 3709.1 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Expand 2 Items
Loading...
Anti-KL Rabbit Polyclonal Antibody

Anti-KL Rabbit Polyclonal Antibody

Supplier: Bioss

May have weak glycosidase activity towards glucuronylated steroids. However, it lacks essential active site Glu residues at positions 239 and 872, suggesting it may be inactive as a glycosidase in vivo. May be involved in the regulation of calcium and phosphorus homeostasis by inhibiting the synthesis of active vitamin D (By similarity). Essential factor for the specific interaction between FGF23 and FGFR1 (By similarity). The Klotho peptide generated by cleavage of the membrane-bound isoform may be an anti-aging circulating hormone which would extend life span by inhibiting insulin/IGF1 signaling.

Expand 1 Items
Loading...

Rat Amylin

Supplier: Anaspec Inc

This is a truncated peptide of native rat amylin. In-vivo and in-vitro studies suggest that it acts as a specific amylin antagonist. In isolated soleus muscle, it blocks amylin-induced inhibition of glycogen synthesis but has no effect in the absence of amylin. Amylin (8-37) increases whole body and muscle insulin sensitivity and consistently reduces basal insulin levels in normal and hGH-induced insulin-resistant rats. It also elicits a significant alteration of in-vivo lipid metabolism.
Sequence: ATQRLANFLVRSSNNLGPVLPPTNVGSNTY - NH2
MW: 3200.6 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Expand 1 Items
Loading...

Anti-CD20 Rabbit Polyclonal Antibody

Supplier: Thermo Scientific

PA5-16701 targets CD20 in IHC (P), FACS and WB applications and shows reactivity with Human, Canine, Feline and Mouse samples. The PA5-16701 immunogen is synthetic peptide derived from C-terminus of human CD20 protein. CD20 is a 33kDa leukocyte surface antigen consisting of four transmembrane regions and cytoplasmic N- and C-termini. CD20 is expressed primarily on B cells but has also been detected on both normal and neoplastic T cells. Activation of CD20 significantly increases DNA synthesis and is thought to involve basic helix-loop-helix leucine zipper transcription factors.

Expand 1 Items
Loading...
Human Recombinant CD74 (from HEK293 Cells)

Human Recombinant CD74 (from HEK293 Cells)

Supplier: Prosci

Cluster of Differentiation 74 (CD74) is also known as HLA class II histocompatibility antigen gamma chain (HLADG), DHLAG, Ia-GAMMA, invariant chain (Abbreviated Ii). CD74 / HLADG is a polypeptide involved in the formation and transport of MHC class II protein. The cell surface form of the invariant chain is known as CD74. CD74 is upregulated in several cancers and is also expressed by non-immune cells during inflammation. CD74 plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha / beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to the endosomal / lysosomal system where the antigen processing and binding of antigenic peptides to MHC class II takes place. CD74 / DHLAG also serves as cell surface receptor for the cytokine MIF.

Expand 1 Items
Loading...
Anti-GALNT6 Rabbit Polyclonal Antibody

Anti-GALNT6 Rabbit Polyclonal Antibody

Supplier: Prosci

GALNT6 is a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAc-T) family of enzymes. GalNAc-Ts initiate mucin-type O-linked glycosylation in the Golgi apparatus by catalyzing the transfer of GalNAc to serine and threonine residues on target proteins. They are characterized by an N-terminal transmembrane domain, a stem region, a lumenal catalytic domain containing a GT1 motif and Gal/GalNAc transferase motif, and a C-terminal ricin/lectin-like domain. GalNAc-Ts have different, but overlapping, substrate specificities and patterns of expression. GALNT6 is capable of glycosylating fibronectin peptide in vitro and is expressed in a fibroblast cell line, indicating that it may be involved in the synthesis of oncofetal fibronectin.This gene encodes a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAc-T) family of enzymes. GalNAc-Ts initiate mucin-type O-linked glycosylation in the Golgi apparatus by catalyzing the transfer of GalNAc to serine and threonine residues on target proteins. They are characterized by an N-terminal transmembrane domain, a stem region, a lumenal catalytic domain containing a GT1 motif and Gal/GalNAc transferase motif, and a C-terminal ricin/lectin-like domain. GalNAc-Ts have different, but overlapping, substrate specificities and patterns of expression. The encoded protein is capable of glycosylating fibronectin peptide in vitro and is expressed in a fibroblast cell line, indicating that it may be involved in the synthesis of oncofetal fibronectin.

Expand 1 Items
Loading...

Anti-INS Mouse Monoclonal Antibody [clone: IRDN/794]

Supplier: Biotium

This antibody recognizes a polypeptide which is identified as insulin, a 51-amino acid polypeptide composed of A and B chains connected through the C-peptide. Proinsulin, which has very little biological activity, is cleaved by proteases within its cell of origin into the insulin molecule and the C-terminal basic residue. Insulin enhances membrane transport of glucose, amino acids, and certain ions. It also promotes glycogen storage, formation of triglycerides, and synthesis of proteins and nucleic acids. Deficiency of insulin results in diabetes mellitus. The main storage site for insulin is the pancreatic islets. Antibodies to insulin are important as beta-cell and insulinoma marker.

Expand 1 Items
Loading...
Anti-ATP5J Rabbit Polyclonal Antibody

Anti-ATP5J Rabbit Polyclonal Antibody

Supplier: Proteintech

ATP5J, also known as coupling factor 6 (CF6), is a soluble integral component of mitochondrial ATP synthase. Mitochondrial ATP synthase is a multi-subunit membrane-bound enzyme that catalyzes the synthesis of ATP by utilizing a proton electrochemical gradient. It consists of three domains, namely the extrinsic and intrinsic membrane domains (F1 and F0, respectively) joined by a stalk.CF6 is one of the subunits in the stalk and an essential component for energy transduction. Recently CF6 has also been reported to play a crucial role in the development of insulin resistance and hypertension. CF6 is first synthesized as an immature form in the cytosol, then transported to the mitochondria by an import signal peptide and becomes an active form with the signal peptide cleaved. Western blot analysis of CF6 demonstrates a single band around 9kD to 12 kD in various tissues including heart, liver, brain and HUVEC (human umbilical vein endothelial cells).

Expand 1 Items
Loading...

Anti-INS Mouse Monoclonal Antibody [clone: IRDN/794]

Supplier: Biotium

This antibody recognizes a polypeptide which is identified as insulin, a 51-amino acid polypeptide composed of A and B chains connected through the C-peptide. Proinsulin, which has very little biological activity, is cleaved by proteases within its cell of origin into the insulin molecule and the C-terminal basic residue. Insulin enhances membrane transport of glucose, amino acids, and certain ions. It also promotes glycogen storage, formation of triglycerides, and synthesis of proteins and nucleic acids. Deficiency of insulin results in diabetes mellitus. The main storage site for insulin is the pancreatic islets. Antibodies to insulin are important as beta-cell and insulinoma marker.

Expand 2 Items
Loading...

Anti-INS Mouse Monoclonal Antibody [clone: IRDN/805]

Supplier: Biotium

This antibody recognizes a polypeptide which is identified as insulin, a 51-amino acid polypeptide composed of A and B chains connected through the C-peptide. Proinsulin, which has very little biological activity, is cleaved by proteases within its cell of origin into the insulin molecule and the C-terminal basic residue. Insulin enhances membrane transport of glucose, amino acids, and certain ions. It also promotes glycogen storage, formation of triglycerides, and synthesis of proteins and nucleic acids. Deficiency of insulin results in diabetes mellitus. The main storage site for insulin is the pancreatic islets. Antibodies to insulin are important as beta-cell and insulinoma marker.

Expand 2 Items
Loading...

Anti-INS Mouse Monoclonal Antibody (Biotin) [clone: IRDN/805]

Supplier: Biotium

This antibody recognizes a polypeptide which is identified as insulin, a 51-amino acid polypeptide composed of A and B chains connected through the C-peptide. Proinsulin, which has very little biological activity, is cleaved by proteases within its cell of origin into the insulin molecule and the C-terminal basic residue. Insulin enhances membrane transport of glucose, amino acids, and certain ions. It also promotes glycogen storage, formation of triglycerides, and synthesis of proteins and nucleic acids. Deficiency of insulin results in diabetes mellitus. The main storage site for insulin is the pancreatic islets. Antibodies to insulin are important as beta-cell and insulinoma marker.

Expand 2 Items
Loading...

Anti-INS Mouse Monoclonal Antibody [clone: IRDN/805]

Supplier: Biotium

This antibody recognizes a polypeptide which is identified as insulin, a 51-amino acid polypeptide composed of A and B chains connected through the C-peptide. Proinsulin, which has very little biological activity, is cleaved by proteases within its cell of origin into the insulin molecule and the C-terminal basic residue. Insulin enhances membrane transport of glucose, amino acids, and certain ions. It also promotes glycogen storage, formation of triglycerides, and synthesis of proteins and nucleic acids. Deficiency of insulin results in diabetes mellitus. The main storage site for insulin is the pancreatic islets. Antibodies to insulin are important as beta-cell and insulinoma marker.

Expand 1 Items
Loading...

Anti-INS Mouse Monoclonal Antibody (Biotin) [clone: IRDN/794]

Supplier: Biotium

This antibody recognizes a polypeptide which is identified as insulin, a 51-amino acid polypeptide composed of A and B chains connected through the C-peptide. Proinsulin, which has very little biological activity, is cleaved by proteases within its cell of origin into the insulin molecule and the C-terminal basic residue. Insulin enhances membrane transport of glucose, amino acids, and certain ions. It also promotes glycogen storage, formation of triglycerides, and synthesis of proteins and nucleic acids. Deficiency of insulin results in diabetes mellitus. The main storage site for insulin is the pancreatic islets. Antibodies to insulin are important as beta-cell and insulinoma marker.

Expand 2 Items
Loading...
Anti-P4HA1 Rabbit Polyclonal Antibody

Anti-P4HA1 Rabbit Polyclonal Antibody

Supplier: Proteintech

P4HA1(Prolyl 4-hydroxylase subunit alpha-1) is also named as P4HA and belongs to the P4HA family ,which play a central role in collagen synthesis. P4HA1 catalyzes the post-translational formation of 4-hydroxyproline in -Xaa-Pro-Gly- sequences in collagens and other proteins. The gene encodes a polypeptide of 517 amino acid residues and a signal peptide of 17 amino acids and the full length protein has two glycosylation sites(uniprot). It can exsit as a heteromer, dimer or tetramer(GENATLAS). P4HA1 has 3 isoforms produced by alternative splicing with the molecular weight of 61-63 kDa and 57-59 kDa.

Expand 1 Items
Loading...
Anti-P4HA1 Mouse Monoclonal Antibody [clone: 1H10A6]

Anti-P4HA1 Mouse Monoclonal Antibody [clone: 1H10A6]

Supplier: Proteintech

P4HA1(Prolyl 4-hydroxylase subunit alpha-1) is also named as P4HA and belongs to the P4HA family ,which play a central role in collagen synthesis. P4HA1 catalyzes the post-translational formation of 4-hydroxyproline in -Xaa-Pro-Gly- sequences in collagens and other proteins. The gene encodes a polypeptide of 517 amino acid residues and a signal peptide of 17 amino acids and the full length protein has two glycosylation sites(uniprot). It can exsit as a heteromer, dimer or tetramer(GENATLAS). P4HA1 has 3 isoforms produced by alternative splicing with the molecular weight of 61 kDa, 61 kDa and 59 kDa. This antibody is specific to P4HA1.

Expand 1 Items
Loading...
Anti-GALNT6 Rabbit Polyclonal Antibody

Anti-GALNT6 Rabbit Polyclonal Antibody

Supplier: Prosci

GALNT6 is a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAc-T) family of enzymes. GalNAc-Ts initiate mucin-type O-linked glycosylation in the Golgi apparatus by catalyzing the transfer of GalNAc to serine and threonine residues on target proteins. They are characterized by an N-terminal transmembrane domain, a stem region, a lumenal catalytic domain containing a GT1 motif and Gal/GalNAc transferase motif, and a C-terminal ricin/lectin-like domain. GalNAc-Ts have different, but overlapping, substrate specificities and patterns of expression. GALNT6 is capable of glycosylating fibronectin peptide in vitro and is expressed in a fibroblast cell line, indicating that it may be involved in the synthesis of oncofetal fibronectin.This gene encodes a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAc-T) family of enzymes. GalNAc-Ts initiate mucin-type O-linked glycosylation in the Golgi apparatus by catalyzing the transfer of GalNAc to serine and threonine residues on target proteins. They are characterized by an N-terminal transmembrane domain, a stem region, a lumenal catalytic domain containing a GT1 motif and Gal/GalNAc transferase motif, and a C-terminal ricin/lectin-like domain. GalNAc-Ts have different, but overlapping, substrate specificities and patterns of expression. The encoded protein is capable of glycosylating fibronectin peptide in vitro and is expressed in a fibroblast cell line, indicating that it may be involved in the synthesis of oncofetal fibronectin. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-3 BC035822.1 1-3 4-130 DB001644.1 179-305 131-2654 BC035822.1 134-2657 2655-4520 AC046135.15 108099-109964 c

Expand 1 Items
Loading...

Anti-INS Mouse Monoclonal Antibody (CF568) [clone: IRDN/794]

Supplier: Biotium

This antibody recognizes a polypeptide which is identified as insulin, a 51-amino acid polypeptide composed of A and B chains connected through the C-peptide. Proinsulin, which has very little biological activity, is cleaved by proteases within its cell of origin into the insulin molecule and the C-terminal basic residue. Insulin enhances membrane transport of glucose, amino acids, and certain ions. It also promotes glycogen storage, formation of triglycerides, and synthesis of proteins and nucleic acids. Deficiency of insulin results in diabetes mellitus. The main storage site for insulin is the pancreatic islets. Antibodies to insulin are important as beta-cell and insulinoma marker.

CF® dyes are Biotium's next-generation fluorescent dyes. CF®568 is a red fluorescent dye (Ex/Em 562/583 nm) with superior brightness and photostability. It also is compatible with super-resolution imaging by STORM and TIRF.

Expand 2 Items
Loading...

Anti-INS Mouse Monoclonal Antibody (CF594) [clone: IRDN/794]

Supplier: Biotium

This antibody recognizes a polypeptide which is identified as insulin, a 51-amino acid polypeptide composed of A and B chains connected through the C-peptide. Proinsulin, which has very little biological activity, is cleaved by proteases within its cell of origin into the insulin molecule and the C-terminal basic residue. Insulin enhances membrane transport of glucose, amino acids, and certain ions. It also promotes glycogen storage, formation of triglycerides, and synthesis of proteins and nucleic acids. Deficiency of insulin results in diabetes mellitus. The main storage site for insulin is the pancreatic islets. Antibodies to insulin are important as beta-cell and insulinoma marker.

CF® dyes are Biotium's next-generation fluorescent dyes. CF®594 is a deep red fluorescent dye (Ex/Em 593/614 nm). It yields the brightest conjugates among spectrally similar dyes, and has excellent photostability.

Expand 2 Items
Loading...
Sort By
Recommended for You