1007 Results for: "peptide synthesis"
Mouse Recombinant HLADG
Supplier: Prosci
Mouse HLA class II histocompatibility antigen gamma chain (CD74), is a single-pass type II membrane protein that in humans is encoded by the CD74 gene. It contains 1 thyroglobulin type-1 domain. CD74 Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to compartments where peptide loading of class II takes place.
Expand 1 Items
Anti-CYP11A1 Rabbit Polyclonal Antibody
Supplier: Bioss
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the mitochondrial inner membrane and catalyzes the conversion of cholesterol to pregnenolone, the first and rate-limiting step in the synthesis of the steroid hormones. Two transcript variants encoding different isoforms have been found for this gene. The cellular location of the smaller isoform is unclear since it lacks the mitochondrial-targeting transit peptide. [provided by RefSeq, Jul 2008]
Expand 1 Items
Human/Mouse Recombinant TGF-B 3 (from E. coli)
Supplier: VWR International
Transforming growth factors (TGFs) are multifunctional peptides that regulate growth and differentiation in most cell types. The TGF-β family of proteins signal through serine/threonine kinase receptors. TGF-β isoforms (TGF-β1, -β2, and –β3) have overlapping, yet distinct biological actions in developing and adult tissues. TGF-β3 is an important factor in regulating cell adhesion and accelerating wound repair. TGF-β3 also functions during osteoblast proliferation, chemotaxis, and collagen synthesis.
Expand 4 Items
Anti-GGT6 Rabbit Polyclonal Antibody (Alexa Fluor® 750)
Supplier: Bioss
GGT6 belongs to the gamma-glutamyltransferase family. GGT is a membrane-bound extracellular enzyme that cleaves gamma-glutamyl peptide bonds in glutathione and other peptides and transfers the gamma-glutamyl moiety to acceptors. GGT is also key to glutathione homeostasis because it provides substrates for glutathione synthesis. GGT6 has very limited amino acid similarity to GGT1 and it's enzymatic activities are currently uncharacterized. GGT assays are of current widespread clinical use to help assess tissue damage.
Expand 1 Items
Anti-CYP11A1 Rabbit Polyclonal Antibody (Cy7®)
Supplier: Bioss
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the mitochondrial inner membrane and catalyzes the conversion of cholesterol to pregnenolone, the first and rate-limiting step in the synthesis of the steroid hormones. Two transcript variants encoding different isoforms have been found for this gene. The cellular location of the smaller isoform is unclear since it lacks the mitochondrial-targeting transit peptide. [provided by RefSeq, Jul 2008]
Expand 1 Items
Anti-GGT6 Rabbit Polyclonal Antibody (Alexa Fluor® 680)
Supplier: Bioss
GGT6 belongs to the gamma-glutamyltransferase family. GGT is a membrane-bound extracellular enzyme that cleaves gamma-glutamyl peptide bonds in glutathione and other peptides and transfers the gamma-glutamyl moiety to acceptors. GGT is also key to glutathione homeostasis because it provides substrates for glutathione synthesis. GGT6 has very limited amino acid similarity to GGT1 and it's enzymatic activities are currently uncharacterized. GGT assays are of current widespread clinical use to help assess tissue damage.
Expand 1 Items
Human/Mouse Recombinant H/M TGF-B 3 (from E. coli cells)
Supplier: VWR International
Transforming growth factors (TGFs) are multifunctional peptides that regulate growth and differentiation in most cell types. The TGF-β family of proteins signal through serine/threonine kinase receptors. TGF-β isoforms (TGF-β1, -β2, and –β3) have overlapping, yet distinct biological actions in developing and adult tissues. TGF-β3 is an important factor in regulating cell adhesion and accelerating wound repair. TGF-β3 also functions during osteoblast proliferation, chemotaxis, and collagen synthesis.
Expand 4 Items
Anti-GALNT10 Rabbit Polyclonal Antibody
Supplier: Prosci
GALNT10 Antibody: Protein glycosylation is an important biological process that is carried out by a large family of glycosyltransferases that catalyze the synthesis of oligosaccharides and glycoconjugates. Polypeptide GalNAc transferases initiate the synthesis of mucin-type oligosaccharides by transferring GalNAc from UDP-GalNAc to the hydroxyl group of either a serine or threonine residue on the polypeptide acceptor. Polypeptide galactoaminyltransferase 10 (GALNT10) belongs to the polypeptide N-acetylgalactosaminyl-transferase (pp-GalNAc-T) protein family. Following expression in insect cells, recombinant GALNT10 showed significant GalNAcT activity toward mucin-derived peptides, and it utilized both non-glycosylated and glycosylated peptide substrates. GALNT10 mRNA is highly expressed in several distinct hypothalamic, thalamic, and amygdaloid nuclei in mouse brain. At least four isoforms of GALNT10 are known to exist.
Expand 1 Items
Human/Mouse Recombinant H/M TGF-B 3 (from E. coli cells)
Supplier: VWR International
Transforming growth factors (TGFs) are multifunctional peptides that regulate growth and differentiation in most cell types. The TGF-β family of proteins signal through serine/threonine kinase receptors. TGF-β isoforms (TGF-β1, -β2, and –β3) have overlapping, yet distinct biological actions in developing and adult tissues. TGF-β3 is an important factor in regulating cell adhesion and accelerating wound repair. TGF-β3 also functions during osteoblast proliferation, chemotaxis, and collagen synthesis.
Expand 4 Items
Boc-Ala-Ala-OH
Supplier: Bachem Americas
For Boc-dipeptides Boc-Xaa-Gly-OH and Boc-Xaa-Pro-OH, which can be used as building blocks during Boc-SPPS, please see the product family 'Boc-Dipeptide Building Blocks' in the 'Amino Acid Derivatives' section. This family also includes short protected peptide fragments suitable for solution synthesis and preparation of enzyme substrates and inhibitors.
Expand 2 Items
Boc-Ala-Ala-Pro-OH
Supplier: Bachem Americas
For Boc-dipeptides Boc-Xaa-Gly-OH and Boc-Xaa-Pro-OH, which can be used as building blocks during Boc-SPPS, please see the product family 'Boc-Dipeptide Building Blocks' in the 'Amino Acid Derivatives' section. This family also includes short protected peptide fragments suitable for solution synthesis and preparation of enzyme substrates and inhibitors.
Expand 2 Items
Anti-CYP11A1 Rabbit Polyclonal Antibody (HRP (Horseradish Peroxidase))
Supplier: Bioss
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the mitochondrial inner membrane and catalyzes the conversion of cholesterol to pregnenolone, the first and rate-limiting step in the synthesis of the steroid hormones. Two transcript variants encoding different isoforms have been found for this gene. The cellular location of the smaller isoform is unclear since it lacks the mitochondrial-targeting transit peptide. [provided by RefSeq, Jul 2008]
Expand 1 Items
Human/Mouse Recombinant TGF-B 3 (from E. coli)
Supplier: VWR International
Transforming growth factors (TGFs) are multifunctional peptides that regulate growth and differentiation in most cell types. The TGF-β family of proteins signal through serine/threonine kinase receptors. TGF-β isoforms (TGF-β1, -β2, and –β3) have overlapping, yet distinct biological actions in developing and adult tissues. TGF-β3 is an important factor in regulating cell adhesion and accelerating wound repair. TGF-β3 also functions during osteoblast proliferation, chemotaxis, and collagen synthesis.
Expand 4 Items
[Asp370]-Tyrosinase (368-376)
Supplier: Anaspec Inc
This tumor antigenic peptide presented by HLA-A2 antigen to CTLs, is a tyrosinase fragment. Tyrosinase is a membrane-bound protein involved in the melanin synthesis pathway that is expressed by virtually all primary melanoma lesions and by most of metastatic lesions.
Sequence:YMDGTMSQV
MW:1031.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
Anti-GALNT10 Rabbit Polyclonal Antibody
Supplier: Prosci
GALNT10 Antibody: Protein glycosylation is an important biological process that is carried out by a large family of glycosyltransferases that catalyze the synthesis of oligosaccharides and glycoconjugates. Polypeptide GalNAc transferases initiate the synthesis of mucin-type oligosaccharides by transferring GalNAc from UDP-GalNAc to the hydroxyl group of either a serine or threonine residue on the polypeptide acceptor. Polypeptide galactoaminyltransferase 10 (GALNT10) belongs to the polypeptide N-acetylgalactosaminyl-transferase (pp-GalNAc-T) protein family. Following expression in insect cells, recombinant GALNT10 showed significant GalNAcT activity toward mucin-derived peptides, and it utilized both non-glycosylated and glycosylated peptide substrates. GALNT10 mRNA is highly expressed in several distinct hypothalamic, thalamic, and amygdaloid nuclei in mouse brain. At least four isoforms of GALNT10 are known to exist.
Expand 1 Items
Boc-Ala-Gly-Gly-OH
Supplier: Bachem Americas
For Boc-dipeptides Boc-Xaa-Gly-OH and Boc-Xaa-Pro-OH, which can be used as building blocks during Boc-SPPS, please see the product family 'Boc-Dipeptide Building Blocks' in the 'Amino Acid Derivatives' section. This family also includes short protected peptide fragments suitable for solution synthesis and preparation of enzyme substrates and inhibitors.
Expand 1 Items
Boc-Val-Val-OH
Supplier: Bachem Americas
For Boc-dipeptides Boc-Xaa-Gly-OH and Boc-Xaa-Pro-OH, which can be used as building blocks during Boc-SPPS, please see the product family 'Boc-Dipeptide Building Blocks' in the 'Amino Acid Derivatives' section. This family also includes short protected peptide fragments suitable for solution synthesis and preparation of enzyme substrates and inhibitors.
Expand 1 Items
Anti-GALNT10 Rabbit Polyclonal Antibody
Supplier: Prosci
GALNT10 Antibody: Protein glycosylation is an important biological process that is carried out by a large family of glycosyltransferases that catalyze the synthesis of oligosaccharides and glycoconjugates. Polypeptide GalNAc transferases initiate the synthesis of mucin-type oligosaccharides by transferring GalNAc from UDP-GalNAc to the hydroxyl group of either a serine or threonine residue on the polypeptide acceptor. Polypeptide galactoaminyltransferase 10 (GALNT10) belongs to the polypeptide N-acetylgalactosaminyl-transferase (pp-GalNAc-T) protein family. Following expression in insect cells, recombinant GALNT10 showed significant GalNAcT activity toward mucin-derived peptides, and it utilized both non-glycosylated and glycosylated peptide substrates. GALNT10 mRNA is highly expressed in several distinct hypothalamic, thalamic, and amygdaloid nuclei in mouse brain. At least four isoforms of GALNT10 are known to exist.
Expand 1 Items
Anti-TH Rabbit Polyclonal Antibody
Supplier: Prosci
Tyrosine Hydroxylase (TH) is the rate-limiting enzyme in the synthesis of the catecholamines Dopamine and Norepinephrine. TH antibodies can therefore be used as markers for dopaminergic and noradrenergic neurons. We raised this polyclonal antibody against a peptide representing the sequence around Ser19 in rat TH purified. This antibody is suitable for most immunochemical applications in a variety of mammalian and some non-mammalian species.
Expand 1 Items
Anti-GALNT10 Rabbit Polyclonal Antibody
Supplier: Prosci
GALNT10 Antibody: Protein glycosylation is an important biological process that is carried out by a large family of glycosyltransferases that catalyze the synthesis of oligosaccharides and glycoconjugates. Polypeptide GalNAc transferases initiate the synthesis of mucin-type oligosaccharides by transferring GalNAc from UDP-GalNAc to the hydroxyl group of either a serine or threonine residue on the polypeptide acceptor. Polypeptide galactoaminyltransferase 10 (GALNT10) belongs to the polypeptide N-acetylgalactosaminyl-transferase (pp-GalNAc-T) protein family. Following expression in insect cells, recombinant GALNT10 showed significant GalNAcT activity toward mucin-derived peptides, and it utilized both non-glycosylated and glycosylated peptide substrates. GALNT10 mRNA is highly expressed in several distinct hypothalamic, thalamic, and amygdaloid nuclei in mouse brain. At least four isoforms of GALNT10 are known to exist.
Expand 1 Items
Boc-Gly-Gly-Gly-OH
Supplier: Bachem Americas
For Boc-dipeptides Boc-Xaa-Gly-OH and Boc-Xaa-Pro-OH, which can be used as building blocks during Boc-SPPS, please see the product family 'Boc-Dipeptide Building Blocks' in the 'Amino Acid Derivatives' section. This family also includes short protected peptide fragments suitable for solution synthesis and preparation of enzyme substrates and inhibitors.
Expand 2 Items
Boc-Gly-Gly-Phe-Gly-OH
Supplier: Bachem Americas
For Boc-dipeptides Boc-Xaa-Gly-OH and Boc-Xaa-Pro-OH, which can be used as building blocks during Boc-SPPS, please see the product family 'Boc-Dipeptide Building Blocks' in the 'Amino Acid Derivatives' section. This family also includes short protected peptide fragments suitable for solution synthesis and preparation of enzyme substrates and inhibitors.
Expand 2 Items
PR39 propeptide
Supplier: Enzo Life Sciences
A proline-arginine-rich peptide antibiotic. PR39 inhibits DNA and protein synthesis and the degradation of HIF-1alpha. It has been reported to bind to the alpha7 subunit of the 26S proteasome, blocking degradation of the NK-κB inhibitor, IκBα by the ubiquitin-proteasome pathway without affecting overall proteasome activity. More recent studies have demonstrated it to be an efficient inhibitor of all activities of the 20S proteasome.
Expand 1 Items
Boc-Phe-Phe-OH
Supplier: Bachem Americas
For Boc-dipeptides Boc-Xaa-Gly-OH and Boc-Xaa-Pro-OH, which can be used as building blocks during Boc-SPPS, please see the product family 'Boc-Dipeptide Building Blocks' in the 'Amino Acid Derivatives' section. This family also includes short protected peptide fragments suitable for solution synthesis and preparation of enzyme substrates and inhibitors.
Expand 1 Items
Human Recombinant Calcitonin gene-related peptide 2 (from E. coli)
Supplier: Prosci
CALCB is a member of the calcitonin family. CALCB is produced in both peripheral and central neurons. It is a potent peptide vasodilator and can function in the transmission of pain. In the spinal cord, the function and expression of CGRP may differ depending on the location of synthesis. CALCB is derived mainly from the cell bodies of motor neurons when synthesized in the ventral horn of the spinal cord and may contribute to the regeneration of nervous tissue after injury.
Expand 1 Items
Bovine;Human;Pig Glucagon (1-29), FAM-labeled, FAM (Carboxyfluorescein)
Supplier: Anaspec Inc
This is a fluorescent (FAM)-labeled Glucagon peptide, Abs/Em=494/521 nm. Glucagon is a peptide hormone secreted from the pancreatic Islet of Langerhans alpha-cells in response to low circulating blood glucose levels in order to restore normal glucose levels. It acts on hepatic enzymes that regulate glucose production and glycogen synthesis. Excessive amounts of circulating glucagon levels is implicated in the metabolic dysregulation of type 2 diabetes, since such conditions result in hyperglycaemia.
Sequence: FAM-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
MW: 3841.1 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Expand 1 Items
Anti-CRHBP Rabbit Polyclonal Antibody (Alexa Fluor® 680)
Supplier: Bioss
CRHBP is a potent stimulator of synthesis and secretion of preopiomelanocortin derived peptides. Although CRH concentrations in the human peripheral circulation are normally low, they increase throughout pregnancy and fall rapidly after parturition. Maternal plasma CRH probably originates from the placenta. Human plasma contains a CRH binding protein which inactivates CRH and which may prevent inappropriate pituitary adrenal stimulation in pregnancy.
Expand 1 Items
Mouse Mgp100 (25-33)
Supplier: Anaspec Inc
This peptide sequence is found in residues 25 to 33 of the mouse self/tumor antigen glycoprotein (mgp100). This fragment is a H-2Db–restricted epitope recognized by CD8+ T cells. Mgp100 is an enzyme normally involved in pigment synthesis, and the epitope fragment is typically expressed in both normal melanocytes and melanoma cells.
Sequence:EGSRNQDWL
MW:1104.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Expand 1 Items
Anti-CRHBP Rabbit Polyclonal Antibody (Alexa Fluor® 750)
Supplier: Bioss
CRHBP is a potent stimulator of synthesis and secretion of preopiomelanocortin derived peptides. Although CRH concentrations in the human peripheral circulation are normally low, they increase throughout pregnancy and fall rapidly after parturition. Maternal plasma CRH probably originates from the placenta. Human plasma contains a CRH binding protein which inactivates CRH and which may prevent inappropriate pituitary adrenal stimulation in pregnancy.
Expand 1 Items
Anti-FDX1 Rabbit Polyclonal Antibody
Supplier: Proteintech
FDX1(Ferredoxin-1) is also named as ADX, FDX, YAH1, LOH11CR1D and belongs to the adrenodoxin/putidaredoxin family. It is a small iron-sulfur protein that transfers electrons from NADPH through ferredoxin reductase to a terminal cytochrome P450 and it can can only reduce mitochondrial CYP enzymes that are essential in adrenal steroidogenesis, bile acid formation, and vitamin D synthesis. The full length has a transit peptide of 60 amino acid.