78 Results for: "matrix modifier"

Supplier: MilliporeSigma

Palladium matrix modifier for graphite furnace AAS.

Supplier: PerkinElmer

This 1% Pd as nitrate matrix modifier is used for Atomic Absorption (AA) THGA graphite furnaces.

Supplier: MilliporeSigma

Magnesium matrix modifier for graphite furnace AAS.

Supplier: Ricca Chemical

VeriSpec* Palladium Nitrate Matrix Modifier Standard 2000 ppm in 1% HNO3 for AAS, Physical State: Liquid, NIST traceable certificate, Volume: 50 mL Poly Natural

Supplier: Thermo Scientific Chemicals

Magnesium nitrate solution 1% in nitric acid 5%, Specpure® matrix modifier solution

Supplier: Ricca Chemical

Magnesium nitrate solution 10000 ppm in water, VeriSpec™ matrix modifier solution, for atomic absorption spectroscopy

Supplier: Ricca Chemical

Ammonium nitrate 50000 ppm in water, VeriSpec™ matrix modifier solution, for atomic absorption spectroscopy

Supplier: Ricca Chemical

Palladium(II) nitrate 5000 ppm in nitric acid 1%, VeriSpec™ matrix modifier solution, for atomic absorption spectroscopy

Supplier: Ricca Chemical

Magnesium nitrate solution 20 g/L in water, VeriSpec™ matrix modifier solution, for atomic absorption spectroscopy

Supplier: Ricca Chemical

Nickel (II) nitrate 10000 ppm in nitric acid 1%, VeriSpec™ matrix modifier solution, for atomic absorption spectroscopy

Supplier: Prosci

ST6GALNAC5 belongs to a family of sialyltransferases that modify proteins and ceramides on the cell surface to alter cell-cell or cell-extracellular matrix interactions.ST6GALNAC5 belongs to a family of sialyltransferases that modify proteins and ceramides on the cell surface to alter cell-cell or cell-extracellular matrix interactions (Tsuchida et al., 2003 [PubMed 12668675]).

Supplier: Thermo Scientific Chemicals

Matrix Modifier Solution

Supplier: Prosci

ST6GALNAC6 belongs to a family of sialyltransferases that modify proteins and ceramides on the cell surface to alter cell-cell or cell-extracellular matrix interactions.ST6GALNAC6 belongs to a family of sialyltransferases that modify proteins and ceramides on the cell surface to alter cell-cell or cell-extracellular matrix interactions (Tsuchida et al., 2003 [PubMed 12668675]).

Supplier: Ricca Chemical

0.2% Palladium. Used to support Inductively coupled plasma (ICP) analysis to sharpen the contrast and improve the readability. 500mL.

Supplier: Ricca Chemical

0.5% Palladium. Used to support Inductively coupled plasma (ICP) analysis to sharpen the contrast and improve the readability. 50mL.

Supplier: Ricca Chemical

1.0% Palladium. Used to support Inductively coupled plasma (ICP) analysis to sharpen the contrast and improve the readability. 50mL.

Supplier: Ricca Chemical

Ammonium dihydrogen phosphate 100,000 ppm in nitric acid 1%, VeriSpec™ matrix modifier solution, for atomic absorption spectroscopy

Supplier: Ricca Chemical

Ammonium dihydrogen phosphate 20,000 ppm in nitric acid 1%, VeriSpec™ matrix modifier solution, for atomic absorption spectroscopy

Supplier: Thermo Scientific Chemicals

Palladium(II) nitrate 1% in nitric acid 10%, Specpure® matrix modifier solution

Supplier: Thermo Scientific

This antibody is predicted to react with bovine, mouse and porcine based on sequence homology. DPT is an extracellular matrix protein with possible functions in cell-matrix interactions and matrix assembly. This protein is found in various tissues and many of its tyrosine residues are sulphated. The protein is postulated to modify the behavior of TGF-beta through interaction with decorin.

Supplier: Cytiva

SOURCE 30S is a synthetic high performance, preparative, chromatography medium, based on a 30 µm monosized, rigid polystyrene/divinyl benzene polymer matrix It is modified with sulphonate (S) strong cation exchange groups.

Supplier: Cytiva

Capto Q ImpRes has a strong quarternary anion exchanger coupled to a chemically modified, high-flow agarose matrix.

Supplier: Cytiva

Chelating Sepharose Fast Flow is composed of cross-linked 6% agarose beads modified with iminodiacetic immobilized to the base matrix by stable ether linkages and sufficiently long spacer arms.

Supplier: Cytiva

IMAC Sepharose 6 Fast Flow is composed of cross-linked 6% agarose beads modified with a novel chelating ligand immobilized to the base matrix.

Supplier: StemBioSys

CELLvo™ Ostoeoarthritic Human Chondrocytes (50-70y) are primary, uncultured cells isolated from recently-diseased cadaver cartilage from donors between 50 and 70 years old. Osteoarthritis status is determined by macroscopic inspection using a modified Outerbridge (1960) scale. Cells are isolated by enzymatic digestion prior to cryopreservation.

Supplier: StemBioSys

CELLvo™ Healthy Human Chondrocytes (50-70y) are primary, uncultured cells isolated from recently-diseased cadaver cartilage from donors between 50 and 70 years old. Healthy status is determined by macroscopic inspection of the tissue using a modified outerbridge (1960) scale in order to distinguish healthy joints from those with signs of osteoarthritis. Cells are isolated by enzymatic digestion prior to cryopreservation.

Supplier: Proteintech

LONP1(Lon protease homolog, mitochondrial) is also named as LONP, LONHS, HLON, LON, PRSS15, PIM1, MGC1498 and belongs to the peptidase S16 family. It seems to play a major role in the elimination of oxidatively modified proteins in the mitochondrial matrix. LONP1, also a nuclearly encoded and mitochondrially located stress-responsive protease, is involved in heme-mediated ALAS-1 turnover. It recognizes specific surface determinants or folds, initiates proteolysis at solvent-accessible sites, and generates unfolded polypeptides that are then processively degraded.

Supplier: Anaspec Inc

This peptide is des-gamma-carboxylated osteocalcin/bone Gla protein (BGP). Osteocalcin/BGP is the most abundant non-collagenous protein of the bone extracellular matrix and is secreted by osteoblasts. This des-gamma-carboxylated peptide serves as a substrate for vitamin K-dependent carboxylase, which modifies Glu17, Glu21, and Glu24 to Gla residues.
Sequence: YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV (Disulfide bridge:C23-29)
MW: 5797.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Proteintech

Epigenetic modifications and dynamic changes in chromatin organization by organizer proteins have recently been shown to play an instrumental role in regulating cancer-promoting genes. Special AT-rich binding protein (SATB1) is a unique type of global regulator that integrates higher-order chromatin organization -withregulation of gene expression. SATB1 is a T cell-enriched transcription factor and a chromatin organizer essential for controlling genes that participate in T-cell development and activation. It regulates gene expression by periodically anchoring matrix attachment regions to the nuclear matrix and directly recruiting chromatin-modifying factors. Depending on its posttranslational modifications, SATB1 activates or represses multiple genes.Its expression is regulated by interleukin-4 (IL4) during T helper-2(Th2) cell differentiation.

Supplier: Proteintech

LONP1(Lon protease homolog, mitochondrial) is also named as LONP, LONHS, HLON, LON, PRSS15, PIM1, MGC1498 and belongs to the peptidase S16 family. It seems to play a major role in the elimination of oxidatively modified proteins in the mitochondrial matrix. LONP1, also a nuclearly encoded and mitochondrially located stress-responsive protease, is involved in heme-mediated ALAS-1 turnover. It recognizes specific surface determinants or folds, initiates proteolysis at solvent-accessible sites, and generates unfolded polypeptides that are then processively degraded.