1874 Results for: "Anaspec"

Supplier: Anaspec Inc

Streptavidin

Supplier: Anaspec Inc

HiLyte™ Fluor 532 hydrazide is a carbonyl-reactive fluorescent labeling dye.

Supplier: Anaspec Inc

This biotinylated Aß(1-40) contains a 6-carbon long chain (LC) to provide more accesibility for avidin attachment.

Supplier: Anaspec Inc

Scrambled control peptide of beta-amyloid are often used in studies to compare the effects of wild type Beta-Amyloid (1-40).

Supplier: Anaspec Inc

This peptide is histone H3 (1-35).
Sequence:ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGV
MW:3551.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

A potent peptide inhibitor of Hepatitis Virus C NS3 protease.

Supplier: Anaspec Inc

Serine/threonine phosphatase substrate.
Sequence:KR-pT-IRR
MW:909 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is a scrambled version of the Gap 27 domain of Connexin.
Sequence:REKIITSFIPT
MW:1304.6 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec Inc

Magainin 1, Purity: HPLC >/= to 95%, Molecular Weight: 2409.9, Sequence: GIGKFLHSAGKFGKAFVGEIMKS, Appearance: Lyophilized white powde, it is peptide antibiotics with antibacterial and antiparasitic activities, Storage: -20 deg C, Size: 0.5 mg

Supplier: Anaspec Inc

This peptide is MHC class II antigen E alpha
Sequence:ASFEAQGALANIAVDKA
MW:1675.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This thrombin receptor agonist peptide is a PAR 1 antagonist peptide.
Sequence:FLLRN
MW:661.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec Inc

A vesicular stomatitis virus G (VSV-G) protein fragment.
Sequence:YTDIEMNRLGK
MW:1339.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This synthetic peptide is a substrate for Syk kinase.
Sequence:KEDPDYEWPSAK-NH2
MW:1463.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

The is a reverse sequence of LL-37 used in control experiments.
Sequence: SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFFDGLL
MW: 4493.3 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier: Anaspec Inc

This is a scrambled sequence of LL-37 used in control experiments.
Sequence: GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
MW: 4493.3 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier: Anaspec Inc

An inhibitor of cell attachment to salmosin and vitronectin.
Sequence:GRGDSP
MW:587.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This is a chromogenic substrate for thrombin, Abs=405 nm.
Sequence:f - Pip - R - pNA
MW:552.6 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec Inc

Calcein, AM is a cell-permeant and non-fluorescent compound that is widely used for determining cell viability

Supplier: Anaspec Inc

This peptide spans the C-terminus of histone H3, amino acids 116 to 136.
Sequence:KRVTIMPKDIQLARRIRGERA
MW:2508 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

HiLyte™ Fluor 532 dyes are new members of our proprietary HiLyte™ Fluor series with fluorescence excitation and emission maxima of ~545 nm and ~565 nm, respectively.

Supplier: Anaspec Inc

Sequence: KKPYIL
MW: 761 Da
% peak area by HPLC: 95%
Storage condition: -20°C

Supplier: Anaspec Inc

HLA-B*3501 restricted influenza virus nucleoprotein epitope (383-391).
Sequence: SRYWAIRTR
MW: 1208.4 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Supplier: Anaspec Inc

This is a GSK-3 substrate, it can be used as a substrate for both alpha and beta isoforms of GSK3.
Sequence:RAAVPPSPSLSRHSSPHQSEDEEE
MW:2631.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

HiLyte™ Fluor 532 amine is a carbonyl-reactive fluorescent labeling dye.

Supplier: Anaspec Inc

An H-2b-restricted OVA class II epitope.
Sequence: ISQAVHAAHAEINEAGR
MW: 1773.9 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier: Anaspec Inc

This peptide is a neurotoxin that blocks N-type calcium channels.
Sequence:CKS(Hyp)GSSCS(Hyp)TSYNCCRSCN(Hyp)YTKRCY-NH2
MW:3037.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This peptide is a H-2Kd-restricted epitope from Influenza nucleoprotein (147-155).
Sequence:TYQRTRALV
MW:1107.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This is a control peptide for gp91 ds-tat.
Sequence: YGRKKRRQRRRCLRITRQSR-NH2
MW: 2673.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Supplier: Anaspec Inc

Erktide is a peptide substrate for ERK2 (extracellular regulated protein kinase 2) whose activity is regulated by mitogenic stimuli.
Sequence:IPTTPITTTYFFFK
MW:1677 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

A glutathione-derived heavy metal-detoxifying peptide of higher plants consisting of 2 units of gammaGlu-Cys.
Sequence:(γE-C)2-G
MW:540.6 Da
% peak area by HPLC:95
Storage condition:-20° C