1874 Results for: "Anaspec"

Supplier: Anaspec Inc

West Nile virus (WNV) causes severe neurological disease and fatalities in both human and animal hosts

Supplier: Anaspec Inc

AnaSpec's AggreSure™ beta-Amyloid (1-40) peptide is pretreated and tested for aggregation using AnaSpec's SensoLyte® ThT Aβ40 Aggregation kit (Cat# AS-72213).
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4329.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec Inc

This SensoLyte® high-sensitivity (2pg/mL) beta-Amyloid (1-40) Quantitative ELISA Kit (Mouse/Rat) provides a convenient and quantitative assay for determining mouse/rat beta-Amyloid (1-40) (Aβ40) amount in cell and tissue lysate as well as in body fluids

Supplier: Anaspec Inc

This is beta-amyloid (10-35) with a Lys added on the C-terminus, biotin is attached to the side chain of this Lys.
Sequence: YEVHHQKLVFFAEDVGSNKGAIIGLM-K(Biotin)-NH2
Molecular Weight: 3256.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec Inc

HiLyte™ Fluor 488, SE is an excellent amine-reactive fluorescent labeling dye for generating protein conjugates. The spectrum of HiLyte™ Fluor488 is similar to fluorescein (FITC), resulting in an optimal match to filters designed for fluorescein.

Supplier: Anaspec Inc

This kit is optimized to detect anti-human MOG (1-125) IgG in human samples. Wells are pre-coated with recombinant human MOG (1-125) protein and pre-blocked with proprietary solution. The amount of anti- human MOG IgG in serum or plasma is quantified using ELISA. Human anti-Human MOG (1-125) standard is included. Ample materials and reagents are provided to perform 96 assays.

Supplier: Anaspec Inc

The SensoLyte® Plus 520 MMP-1 Assay Kit is designed for specifically detecting MMP-1 activity in biological samples which may contain multiple MMPs, such as culture medium, serum, plasma, synovial fluid, and tissue homogenate. A specific anti-MMP-1 monoclonal antibody is used in combination with an MMP fluorogenic substrate, 5-FAM/QXL®520 FRET peptide. The fluorescence signal is monitored at Ex/Em=490 nm/520 nm upon MMP-1-induced cleavage of the FRET substrate. Ample materials are provided to perform 96 assays in a 96-well format.

Supplier: Anaspec Inc

The SensoLyte® Plus 520 MMP-2 Assay Kit is designed specifically for detecting MMP-2 activity in biological samples, such as culture medium, serum, plasma, synovial fluid, and tissue homogenate, which may contain multiple MMPs. A monoclonal anti-human-MMP-2 antibody is employed to pull down MMP-2 from the mixture first. MMP-2 activity is then quantified by a 5-FAM/QXL® 520 fluorescence resonance energy transfer (FRET) peptide. The fluorescence signal is monitored at Ex/Em=490 nm/520 nm upon MMP-2-induced cleavage of the FRET substrate. The long wavelength fluorescence of 5-FAM is less interfered by the autofluorescence of components in biological samples and test compounds. Ample materials are provided to perform 96 assays in a 96-well format.

Supplier: Anaspec Inc

SensoLyte® Anti-PLP (139 - 151) IgG Quantitative ELISA Kit (Mouse) is optimized to detect mouse anti-PLP (139-151) IgG. This kit is useful to researchers who wish to determine the amount of anti-PLP (139-151) antibody present in biological samples, and can help provide information on the role it plays in the development and treatment of EAE, an animal model for MS pathogenesis. Wells are pre-coated with PLP (139-151) peptide and pre-blocked with BSA. The amount of anti-PLP (139-151) IgG in mouse serum or cerebrospinal fluid is quantified using ELISA (Abs=450 nm). Ample materials and reagents are provided to perform 96 assays.

Supplier: Anaspec Inc

SensoLyte® Anti-PLP (178-191) IgG Quantitative ELISA Kit (Mouse) is optimized to detect mouse anti-PLP (178-191) IgG. This kit is useful to researchers who wish to determine the amount of anti-PLP (178-191) antibody present in biological samples, and can help provide information on the role it plays in the development and treatment of EAE, an animal model for MS pathogenesis. Wells are pre-coated with PLP (178-191) peptide and pre-blocked with BSA. The amount of anti-PLP (178-191) IgG in mouse serum or cerebrospinal fluid is quantified using ELISA (Abs=450 nm). Ample materials and reagents are provided to perform 96 assays.

Supplier: Anaspec Inc

West Nile virus (WNV) causes severe neurological disease and fatalities in both human and animal hosts

Supplier: Anaspec Inc

HiLyte™ Fluor 647 acid, SE (Ex/Em=647 nm/ 679 nm) is an excellent fluorescent labeling dye that generates the protein conjugates that are slightly red-shifted compared to those of Cy® 5 dyes, resulting in an optimal match to filters designed for Cy®5 dyes

Supplier: Anaspec Inc

HiLyte™ Fluor 555 acid, SE is an excellent amine-reactive fluorescent labeling dye that generates the protein conjugates that are only slightly red-shifted compared to those of Cy™ 3 dyes, resulting in an optimal match to filters designed for CyTM dyes.

Supplier: Anaspec Inc

This kit is optimized to detect anti-human MOG (1-125) IgG in mouse serum or cerebrospinal fluid. Wells are pre-coated with recombinant human MOG (1-125) protein and pre-blocked with BSA. The amount of anti-human MOG IgG in serum or cerebrospinal fluid is quantified using ELISA. Mouse anti-human MOG IgG standard is included. Ample materials and reagents are provided to perform 96 assays in a 96-well plate format.

Supplier: Anaspec Inc

The SensoLyte® Plus 520 MMP-9 Assay Kit is designed for specifically detecting MMP-9 activity in biological samples which may contain multiple MMPs, such as culture medium, serum, plasma, synovial fluid, and tissue homogenate. A specific anti-MMP-9 monoclonal antibody is used in combination with a MMP fluorogenic substrate, 5-FAM/QXL®520 FRET peptide. The fluorescence signal is monitored at Ex/Em=490 nm/520 nm upon MMP-9-induced cleavage of the FRET substrate. Ample materials are provided to perform 96 assays in a 96-well format.

Supplier: Anaspec Inc

The SensoLyte® Plus 520 MMP-13 Assay Kit is designed for specifically detecting MMP-13 activity in biological samples which may contain multiple MMPs, such as culture medium, serum, plasma, synovial fluid, and tissue homogenate. A specific anti-MMP-13 monoclonal antibody is used in combination with a MMP fluorogenic substrate, 5-FAM/QXL®520 FRET peptide. The fluorescence signal is monitored at Ex/Em=490 nm/520 nm upon MMP-13-induced cleavage of the FRET substrate. Ample materials are provided to perform 96 assays in a 96-well format.

Supplier: Anaspec Inc

MOG peptide fragment (35-55) induces autoantibody production and relapsing-remitting neurological disease causing extensive plaque-like demyelination

Supplier: Anaspec Inc

HiLyte™ Fluor 647 acid, SE (Ex/Em=647 nm/679 nm) is an excellent fluorescent labeling dye that generates the protein conjugates that are slightly red-shifted compared to those of Cy® 5 dyes, resulting in an optimal match to filters designed for Cy®5 dyes

Supplier: Anaspec Inc

HiLyte™ Fluor 555 acid, SE is an excellent amine-reactive fluorescent labeling dye that generates the protein conjugates that are only slightly red-shifted compared to those of Cy™ 3 dyes, resulting in an optimal match to filters designed for CyTM dyes.

Supplier: Anaspec Inc

This is biotinylated Protein A conjugate suitable for asssay development, IHC, IF, immunoprecipitation or western blotting.
AnaSpec's recombinant Protein A consists of only IgG binding domains and was expressed using a recombinant bacterial expression system. Its apparent molecular weight is approximately 30,000 Da compared to 42,000 Da for the native Protein A that is found in Staphylococcus aureus.
Protein A conjugates are widely used as labeled reagents for a variety of experiments including immunoprecipitation, antibody detection and purification and assay development

Supplier: Anaspec Inc

Protein A-HiLyte™ Fluor 488 Conjugate can be used as a universal reagent to detect primary antibodies in IHC from many species including rabbit, human, some mouse IgG isotypes, and others. Fluorescence (green) Excitation/Emission wavelength: 499 nm/523 nm.
AnaSpec's recombinant Protein A consists of only IgG binding domains and was expressed using a recombinant bacterial expression system. Its apparent molecular weight is approximately 30,000 Da compared to 42,000 Da for the native Protein A that is found in Staphylococcus aureus.
Protein A conjugates are widely used as labeled reagents for a variety of experiments including immunoprecipitation, antibody detection and purification and assay development

Supplier: Anaspec Inc

Protein A-HiLyte™ Fluor 555 Conjugate can be used as a universal reagent to detect primary antibodies in IHC from many species including rabbit, human, some mouse IgG isotypes, and others. Fluorescence (orange) Excitation/Emission wavelength: 553 nm/568 nm.
AnaSpec's recombinant Protein A consists of only IgG binding domains and was expressed using a recombinant bacterial expression system. Its apparent molecular weight is approximately 30,000 Da compared to 42,000 Da for the native Protein A that is found in Staphylococcus aureus.
Protein A conjugates are widely used as labeled reagents for a variety of experiments including immunoprecipitation, antibody detection and purification and assay development

Supplier: Anaspec Inc

AnaSpec's recombinant Protein A consists of only IgG binding domains and was expressed using a recombinant bacterial expression system. Its apparent molecular weight is approximately 30,000 Da compared to 42,000 Da for the native Protein A that is found in Staphylococcus aureus.
Protein A is a non-glycosylated cell wall protein of Staphylococcus aureus that can bind the Fc part of immunoglobulin molecule of different species with strong affinity (1-4). Protein A consists of five IgG binding domains (A, B, C, D, and E), each approximately 60 amino acids long with no cysteines present and two S. aureus cell membrane binding domains, X and M (3).
Application: Recombinant Protein A can be used for immunoprecipitation, antibodies purification, and assay development.

Supplier: Anaspec Inc

Protein A-HiLyte™ Fluor 750 Conjugate can be used as a universal reagent to detect primary antibodies in Western Immunoblot from many species including rabbit, human, some mouse IgG isotypes, and others. Fluorescence (near-infrared) Excitation/Emission wavelength: 754 nm/778 nm.
AnaSpec's recombinant Protein A consists of only IgG binding domains and was expressed using a recombinant bacterial expression system. Its apparent molecular weight is approximately 30,000 Da compared to 42,000 Da for the native Protein A that is found in Staphylococcus aureus.
Protein A conjugates are widely used as labeled reagents for a variety of experiments including immunoprecipitation, antibody detection and purification and assay development

Supplier: Anaspec Inc

Protein A-HiLyte™ Fluor 647 Conjugate can be used as a universal reagent to detect primary antibodies in IHC from many species including rabbit, human, some mouse IgG isotypes, and others. Fluorescence (near-infrared) Excitation/Emission wavelength: 649 nm/674 nm.
AnaSpec's recombinant Protein A consists of only IgG binding domains and was expressed using a recombinant bacterial expression system. Its apparent molecular weight is approximately 30,000 Da compared to 42,000 Da for the native Protein A that is found in Staphylococcus aureus.
Protein A conjugates are widely used as labeled reagents for a variety of experiments including immunoprecipitation, antibody detection and purification and assay development

Supplier: Anaspec Inc

AnaSpec offers two types of fluoresceinated collagen (type I). This product is water soluble and is used for quick fluorometric measurement of collagenase activity. In this protease substrate, collagen is heavily labeled with FITC, resulting in almost total quenching of the conjugate's fluorescence. Protease-catalyzed hydrolysis relieves this quenching conjugate, yielding brightly green fluorescent dye-labeled peptides. The increase in fluorescence intensity is directly proportional to protease activity. This fluoresceinated collagen is useful for detecting MMP-1 activity.

Supplier: Anaspec Inc

This FRET peptide is a specific substrate for renin. This renin peptide substrate may be used for screening of renin inhibitors. In the FRET peptide, the fluorescence of 5-FAM is quenched by QXL® 520. Upon cleavage into two separate fragments by renin, the fluorescence of 5-FAM is recovered, and can be monitored at excitation/emission = 490/520 nm. This substrate is employed in the SensoLyte® 520 Renin Assay Kit, cat # AS-72040 from AnaSpec.
MW: 2000 - 2200 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec Inc

Besides water-soluble collagen (Type I) conjugate (Cat#85111), AnaSpec also offers water-insoluble fluoresceinated collagen (type I). It can also be used for fluorometric measurement of collagenase activity. Cat#85102 is the water-insolulbe collagen that is heavily labeled with FITC, resulting in almost total quenching of the conjugates fluorescence. Protease-catalyzed hydrolysis slowly yields brightly green fluorescent dye-labeled peptides. The increase in fluorescence intensity is directly proportional to protease activity. Although this fluoresceinated collagen is more slowly digested by MMP-1 than water-soluble collagen (Cat#85111), it is more specific for the enzyme.

Supplier: Anaspec Inc

The sequence (Accession # NP_003076)) corresponds to the human β-synuclein along with a 6x His tag expressed in E. coli. This human β-synuclein recombinant protein is offered at a low endotoxin level of <0.1 EU per μg protein.
Beta-synuclein belongs to the family of highly conservative proteins in vertebrates. N-terminal of β-synuclein is highly homologous to α-, γ-synucleins and consists of degenerative “KTKEGV” repeats. Similar to α-synuclein, beta-synuclein is found primarily in the brain; however, it does not associate with Lewy bodies in Parkinson disease like α-synuclein. Beta-synuclein was found to inhibit production of phosphatidic acid by the phospholipase D2 transmembrane protein in vitro. In addition, beta-synuclein was detected in many breast and ovarian tumors. Recent investigations demonstrated that beta-synuclein can induce mild experimental autoimmune encephalomyelitis (EAE) in Lewis rats.
The human β-synuclein recombinant proteins from AnaSpec are offered with low endotoxin levels of <1 EU per μg protein.

Supplier: Anaspec Inc

The sequence (Accession # NP_003076)) corresponds to the human β-synuclein along with a 6x His tag expressed in E. coli. This human β-synuclein recombinant protein is offered at a low endotoxin level of <0.1 EU per μg protein.
Beta-synuclein belongs to the family of highly conservative proteins in vertebrates. N-terminal of β-synuclein is highly homologous to α-, γ-synucleins and consists of degenerative “KTKEGV” repeats. Similar to α-synuclein, beta-synuclein is found primarily in the brain; however, it does not associate with Lewy bodies in Parkinson disease like α-synuclein. Beta-synuclein was found to inhibit production of phosphatidic acid by the phospholipase D2 transmembrane protein in vitro. In addition, beta-synuclein was detected in many breast and ovarian tumors. Recent investigations demonstrated that beta-synuclein can induce mild experimental autoimmune encephalomyelitis (EAE) in Lewis rats.
The human β-synuclein recombinant proteins from AnaSpec are offered with low endotoxin levels of <1 EU per μg protein.