1874 Results for: "Anaspec"

Supplier: Anaspec Inc

ACE2 or ACEH, angiotensin-converting enzyme 2, a homolog of angiotensin-converting enzyme, is a novel zinc metallopeptidase with specificity, tissue distribution, and function distinct from those of ACE

Supplier: Anaspec Inc

TACE (tumor necrosis factor-alpha converting enzyme), α-secretase, or ADAM17 is a member of the ADAM family of proteases that contain both disintegrin and metalloprotease (catalytic) domains

Supplier: Anaspec Inc

HCV protease is identified as an important drug-screening target.

Supplier: Anaspec Inc

Hydrogen peroxide is involved in a number of biological events, in particular, free radical-induced biochemical reactions.

Supplier: Anaspec Inc

HIV protease (PR) is identified as an important drug-screening target for the design of selective acquired immunodeficiency syndrome (AIDS) therapeutics.

Supplier: Anaspec Inc

Conjugates of calf intestinal alkaline phosphatase are extensively used as secondary detection reagents in ELISAs, immunohistochemical techniques and Northern, Southern and Western blot analyses

Supplier: Anaspec Inc

Matrix Metalloproteinases (MMPs) are a large family of endopeptidases. Collectively, MMPs can degrade all kinds of extracellular matrix proteins, and can also process a number of bioactive molecules. They are known to be involved in the cleavage of cell surface receptors, the release of apoptotic ligands, and chemokine/cytokine inactivation. MMPs are also thought to play a major role in cell behaviors such as cell proliferation, migration (adhesion/dispersion), differentiation, angiogenesis, apoptosis, and host defense.
This peptide contains 5-FAM only and is similar to the proteolytic product of the 520 MMP FRET substrates. It can be used to set up the fluorescence standard curve. Abs/Em = 494/521 nm.
Sequence:5-FAM-PL
MW:586.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Alkaline phosphatase is a popular enzyme conjugated with secondary antibody for ELISA

Supplier: Anaspec Inc

HiLyte™ Fluor 488, SE is an excellent amine-reactive fluorescent labeling dye for generating protein conjugates. The spectrum of HiLyte™ Fluor488 is similar to fluorescein (FITC), resulting in an optimal match to filters designed for fluorescein.

Supplier: Anaspec Inc

Matrix metalloproteinases (MMPs) belong to a family of secreted or membrane-associated proteins capable of digesting extracellular matrix components

Supplier: Anaspec Inc

This SensoLyte® high-sensitivity (2pg/mL) beta-Amyloid (1-42) Quantitative ELISA Kit (Mouse/Rat) provides a convenient and quantitative assay for determining mouse/rat beta-Amyloid (1-42) (Aβ42) amount in cell and tissue lysate as well as in body fluids

Supplier: Anaspec Inc

Factor Xa (FXa) is a serine endopeptidase composed of two disulfide-linked subunits

Supplier: Anaspec Inc

Fluorescein isothiocyanate (FITC) remains one of the most popular fluorescent labeling reagents, probably due to the low cost of the material. 5-FITC and 6-FITC have very similar absorption and fluorescence spectra. However, the isomers may differ in their binding and reactivity to proteins, and the conjugates may elute under different chromatographic conditions or migrate differently in electrophoretic gels.

Supplier: Anaspec Inc

Matrix Metalloproteinases (MMPs) are a large family of endopeptidases. Collectively, MMPs can degrade all kinds of extracellular matrix proteins, and can also process a number of bioactive molecules. They are known to be involved in the cleavage of cell surface receptors, the release of apoptotic ligands, and chemokine/cytokine inactivation. MMPs are also thought to play a major role in cell behaviors such as cell proliferation, migration (adhesion/dispersion), differentiation, angiogenesis, apoptosis, and host defense.
This peptide is a sensitive substrate for assaying MMP-1, 2, 7, 8, 12 and 13 activities, Abs/Em = 494/521nm.
Sequence:5-FAM-RPKPYA-Nva-WM-K(QXL™ 520)-NH2
MW:2125.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

FDP is a highly sensitive fluorogenic substrate for most phosphatases

Supplier: Anaspec Inc

Plasmin belongs to the family of serine proteases

Supplier: Anaspec Inc

Enterokinase is a heterodimeric serine protease produced by cells in the duodenal wall

Supplier: Anaspec Inc

Thrombin, a serine protease, plays a central role in hemostasis by converting soluble plasma fibrinogen into an insoluble fibrin clot and by promoting platelet aggregation

Supplier: Anaspec Inc

Matriptase (also known as MT-SP1, ST14, TADG-15 and epithin) is a trypsin-like protease from the family of type II transmembrane serine proteases

Supplier: Anaspec Inc

TAMRA is one of the most popular fluorophores used in various bioconjugations. 5-TAMRA is the purified single isomer of 5(6)-TAMRA. It is preferred for some complicated biological applications where reproducibility is more critical than material cost since the minor positional difference between 5-TAMRA and 6-TAMRA might affect some biological properties of the underlying conjugates.

Supplier: Anaspec Inc

Matrix Metalloproteinases (MMPs) are a large family of endopeptidases. Collectively, MMPs can degrade all kinds of extracellular matrix proteins, and can also process a number of bioactive molecules. They are known to be involved in the cleavage of cell surface receptors, the release of apoptotic ligands, and chemokine/cytokine inactivation. MMPs are also thought to play a major role in cell behaviors such as cell proliferation, migration (adhesion/dispersion), differentiation, angiogenesis, apoptosis, and host defense.
This peptides is a sensitive substrate for assaying MMP-2 and 13 activities, Abs/Em = 494/521 nm.
Sequence:QXL™ 520-PLGMWSRK(5-FAM)-NH2
MW:1822.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Matrix Metalloproteinases (MMPs) are a large family of endopeptidases. Collectively, MMPs can degrade all kinds of extracellular matrix proteins, and can also process a number of bioactive molecules. They are known to be involved in the cleavage of cell surface receptors, the release of apoptotic ligands, and chemokine/cytokine inactivation. MMPs are also thought to play a major role in cell behaviors such as cell proliferation, migration (adhesion/dispersion), differentiation, angiogenesis, apoptosis, and host defense.
This peptide is a sensitive substrate for assaying MMP-1, 2, 7, 8, 12 and 13 activities, Abs/Em = 494/521 nm.
Sequence:5-FAM-P-Cha-G-Nva-HA-Dap(QXL™ 520)-NH2
MW:1567.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Matrix Metalloproteinases (MMPs) are a large family of endopeptidases. Collectively, MMPs can degrade all kinds of extracellular matrix proteins, and can also process a number of bioactive molecules. They are known to be involved in the cleavage of cell surface receptors, the release of apoptotic ligands, and chemokine/cytokine inactivation. MMPs are also thought to play a major role in cell behaviors such as cell proliferation, migration (adhesion/dispersion), differentiation, angiogenesis, apoptosis, and host defense.
This peptide is a sensitive substrate for assaying MMP-1, 2, 8, 9, 12, 13 and 14 activities, Abs/Em = 494/521 nm.
Sequence:QXL™ 520-PLGC(Me)HAr-K(5-FAM)-NH2
MW:1743.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Matrix Metalloproteinases (MMPs) are a large family of endopeptidases. Collectively, MMPs can degrade all kinds of extracellular matrix proteins, and can also process a number of bioactive molecules. They are known to be involved in the cleavage of cell surface receptors, the release of apoptotic ligands, and chemokine/cytokine inactivation. MMPs are also thought to play a major role in cell behaviors such as cell proliferation, migration (adhesion/dispersion), differentiation, angiogenesis, apoptosis, and host defense.
This peptide is a sensitive substrate for assaying MMP-1, 2, 7, 8, 12 and 13 activities, Abs/Em = 494/521 nm.
Sequence:QXL™ 520-RPLALWRK(5-FAM)-NH2
MW:1889.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

This kit is optimized to detect anti-mouse MOG (1-125) IgG. Wells are pre-coated with recombinant mouse MOG (1-125) protein and pre-blocked with BSA. The amount of anti-mouse MOG IgG in serum or cerebrospinal fluid is quantified using ELISA. Ample materials and reagents are provided to perform 96 assays.

Supplier: Anaspec Inc

This SensoLyte® high-sensitivity (2pg/mL) beta-Amyloid (1-40) Quantitative ELISA Kit (Mouse/Rat) provides a convenient and quantitative assay for determining mouse/rat beta-Amyloid (1-40) (Aβ40) amount in cell and tissue lysate as well as in body fluids

Supplier: Anaspec Inc

This is beta-amyloid (10-35) with a Lys added on the C-terminus, biotin is attached to the side chain of this Lys.
Sequence: YEVHHQKLVFFAEDVGSNKGAIIGLM-K(Biotin)-NH2
Molecular Weight: 3256.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec Inc

Urokinase-type plasminogen activator (uPA) is a serine protease that functions in the conversion of the zymogen plasminogen to the active, broad-spectrum serine protease plasmin

Supplier: Anaspec Inc

AnaSpec's AggreSure™ beta-Amyloid (1-40) peptide is pretreated and tested for aggregation using AnaSpec's SensoLyte® ThT Aβ40 Aggregation kit (Cat# AS-72213).
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4329.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec Inc

This kit is optimized to detect anti-rat MOG (1-125) IgG. Wells are pre-coated with recombinant rat MOG (1-125) protein and pre-blocked with BSA. The amount of anti-rat MOG IgG in serum or cerebrospinal fluid is quantified using ELISA. Ample materials and reagents are provided to perform 96 assays.